SecReT4
Protein ID: 189423320
T4SS name [ID]Tra_F [601]
Gene symbol-
Locus tagGlov_0248
StrainGeobacter lovleyi SZ
Repliconchromosome [GenBank: NC_010814] [Browse all T4SS(s) in this replicon]
Location [Strand]227290..227796 [+]
Productlytic transglycosylase
Component typeOrf169_F
UniProt IDB3EAZ3
KEGG IDglo:Glov_0248
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 168 a.a.     [Download]
>gi|189423320|ref|YP_001950497.1| lytic transglycosylase [Geobacter lovleyi SZ]
MCRLPGICLLMISLVSLPIQAKAFCFEEAGSQYGISPQLLWSIAKTESNFNPRAINRNSNGTYDYGLMQI
NSSWAKRLGKTWNELGEPCTNVKVGAWVLAQCIQDYGYTWRAVGCYNSRTPSKGDRYAGKVYRILAEHTK
PQATTLIAAISTPRIDSPWDEVFGNAVR
 
Nucleotide Sequence: 507 bp     [Download]
>gi|189423082|ref|NC_010814.1|:227290-227796 Geobacter lovleyi SZ chromosome, complete genome
ATGTGTCGATTACCAGGCATCTGCCTGCTCATGATCAGCCTTGTCAGTTTGCCGATTCAGGCCAAAGCTT
TCTGCTTCGAGGAGGCCGGGAGTCAATACGGCATATCGCCACAGCTGCTCTGGAGCATTGCCAAGACGGA
GAGCAACTTCAACCCCCGTGCGATCAATCGGAACAGTAACGGAACCTACGATTACGGTCTGATGCAGATC
AATTCAAGTTGGGCCAAGAGACTTGGCAAAACATGGAATGAACTGGGAGAGCCATGCACGAATGTAAAGG
TGGGAGCCTGGGTGCTGGCCCAATGTATCCAGGATTATGGCTACACTTGGCGGGCTGTCGGTTGTTACAA
CTCGCGCACCCCGTCGAAGGGGGACCGATACGCCGGGAAAGTGTATCGCATCCTCGCTGAGCATACAAAG
CCACAGGCGACGACGCTTATCGCAGCTATCAGCACACCTAGAATCGATTCACCATGGGATGAGGTGTTCG
GCAATGCTGTCCGCTGA
 Primer design