SecReT4
Protein ID: 189423322
T4SS name [ID]Tra_F [601]
Gene symbol-
Locus tagGlov_0250
StrainGeobacter lovleyi SZ
Repliconchromosome [GenBank: NC_010814] [Browse all T4SS(s) in this replicon]
Location [Strand]228468..229841 [+]
ProductTraG family protein
Component typeTraD_F
UniProt IDB3EAZ5
KEGG IDglo:Glov_0250
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.3e-17, Aligned region: 30..81
TrwB_AAD_bind [PF10412], Evalue: 1.3e-17, Aligned region: 271..386
TraG-D_C [PF12696], Evalue: 1.3e-14, Aligned region: 304..414
AAA_10 [PF12846], Evalue: 4.9e-14, Aligned region: 43..382
T4SS-DNA_transf [PF02534], Evalue: 1.5e-09, Aligned region: 43..382
DUF87 [PF01935], Evalue: 7.4e-07, Aligned region: 32..81
AAA_22 [PF13401], Evalue: 6.2e-05, Aligned region: 41..77
Arch_ATPase [PF01637], Evalue: 7.1e-05, Aligned region: 42..101
Protein Sequence: 457 a.a.     [Download]
>gi|189423322|ref|YP_001950499.1| TraG family protein [Geobacter lovleyi SZ]
MFKSSSHRSTTNPEFMTSIGNGVQMERPTRIVPISIPDEYRKRHMFVFGTTGVGKTRLCENLIEQDIMKG
NSVVYFDPKGDQQIFTKIFEVARRAERLKDLMLVTPIFPEYSAVIDPMAYYFMPDELVGHIVSGIQGGRE
PFYRNIAKEITTAIISANIIIADWEKRLPKQNMDTIRQSIRRSSLSSTMGLLQEIKTPEALLNAGMIQDI
LESPQEYYSKVSSTLRTCLMELSSGNIGKIIGQADSNRFISRLERKKGVIMVVHTGTMITREAATTLGKV
LLSMIQSFIGRVYLSDKQKVFPPLSIYIDEAQSLFYQGIEDLFAKAGSADVMVHAFAQSVNQIYAAIGEE
YGKSILDNTNTKIFMRCSDAETSEYVVRHFGVRNVLTGIFGSNQVTTREVEQDILKVQDILGLQPREFYM
LTYSGRYKGVTRDARDPQLKIVFPSAPSSITMSRGAA
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|189423082|ref|NC_010814.1|:228468-229841 Geobacter lovleyi SZ chromosome, complete genome
ATGTTCAAGTCCTCATCGCACCGTAGCACCACCAACCCGGAATTCATGACCTCCATCGGTAACGGAGTCC
AGATGGAACGACCGACCCGGATCGTTCCGATTTCGATCCCTGATGAATACCGAAAACGGCACATGTTCGT
ATTTGGCACTACCGGGGTCGGCAAAACGCGACTCTGCGAGAACCTAATTGAGCAGGACATCATGAAAGGC
AACAGCGTGGTCTACTTCGACCCCAAAGGTGACCAGCAGATCTTCACCAAGATTTTCGAGGTTGCCCGTA
GGGCGGAGAGACTCAAGGATTTGATGCTGGTAACGCCGATTTTCCCGGAATACTCAGCGGTCATCGATCC
TATGGCCTATTACTTCATGCCGGACGAACTCGTCGGCCATATCGTCTCAGGCATCCAGGGCGGACGTGAA
CCATTCTACCGCAACATTGCAAAGGAAATCACTACTGCCATCATCTCAGCCAACATCATCATCGCCGATT
GGGAAAAACGTCTTCCCAAGCAAAATATGGATACTATCAGACAAAGCATTCGCCGCTCATCATTGAGCAG
CACAATGGGGCTACTGCAAGAAATCAAGACACCCGAGGCGCTGCTAAACGCCGGCATGATCCAGGACATC
CTTGAATCTCCCCAGGAGTATTATTCGAAGGTGTCTTCAACATTACGTACCTGCTTGATGGAGCTTTCCT
CCGGGAACATCGGCAAGATTATCGGTCAGGCCGACAGCAACCGCTTCATCAGCCGACTTGAACGAAAGAA
AGGGGTCATCATGGTCGTGCACACCGGCACCATGATTACCAGGGAGGCAGCCACAACACTTGGCAAAGTC
CTCTTGTCGATGATCCAGTCTTTCATCGGCAGGGTCTATCTCTCTGACAAACAGAAAGTATTCCCACCAC
TGTCCATCTACATAGATGAGGCCCAGAGCCTGTTCTACCAAGGTATTGAGGACCTTTTCGCCAAGGCTGG
ATCAGCAGACGTAATGGTGCACGCCTTCGCCCAGTCCGTGAACCAAATATATGCCGCCATTGGTGAGGAA
TACGGCAAATCGATCCTCGACAACACCAACACCAAGATCTTCATGCGCTGTTCTGATGCTGAAACATCCG
AGTACGTCGTACGGCATTTCGGCGTGCGCAACGTGCTGACCGGCATTTTCGGGTCCAACCAGGTCACTAC
CCGTGAAGTGGAACAGGACATTTTGAAAGTGCAGGATATTCTGGGGCTGCAACCAAGGGAATTCTACATG
CTGACCTACTCCGGTAGGTACAAGGGTGTGACTCGTGATGCCAGAGACCCGCAGTTGAAGATAGTCTTCC
CGTCGGCGCCATCTTCCATAACCATGAGCAGAGGGGCCGCATGA
 Primer design