SecReT4
Protein ID: 189423324
T4SS name [ID]Tra_F [601]
Gene symbol-
Locus tagGlov_0252
StrainGeobacter lovleyi SZ
Repliconchromosome [GenBank: NC_010814] [Browse all T4SS(s) in this replicon]
Location [Strand]231301..232137 [+]
Productglutaredoxin
Component typeTraF_F
UniProt IDB3EAZ7
KEGG IDglo:Glov_0252
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.4e-46, Aligned region: 28..238
DUF836 [PF05768], Evalue: 7.6e-07, Aligned region: 160..208
Thioredoxin [PF00085], Evalue: 7.7e-06, Aligned region: 155..222
Protein Sequence: 278 a.a.     [Download]
>gi|189423324|ref|YP_001950501.1| glutaredoxin [Geobacter lovleyi SZ]
MRRLILASILQLSVTTASAGYYADSAKGWWWYQKEPEKQAEKQEKKKKPPKSTPSLKDYSYEQVWEMHPD
QFQEFAEVLKKKAVQKPSEENVKEYFEVQEIARKKALAFSNVAQFVWQKYPELTTKKDYPITTPGNLARI
SQINEERQRILRDNRDDFALIYFQRPDCSYCDEQSRILDWFTNETGWTVKKVNISENPGLAAKFSVEITP
TLILIQKGNQDYLPVSAGVISADEIEDKAYRAVRLLKGDISPEEYSLYEFQKGGSFDVKKRRLQEERP
 
Nucleotide Sequence: 837 bp     [Download]
>gi|189423082|ref|NC_010814.1|:231301-232137 Geobacter lovleyi SZ chromosome, complete genome
ATGAGGAGACTGATACTGGCCTCTATTCTCCAACTCTCCGTGACCACCGCTTCTGCCGGCTATTATGCCG
ACTCGGCCAAGGGCTGGTGGTGGTACCAGAAAGAACCTGAGAAGCAGGCCGAAAAGCAGGAAAAGAAGAA
GAAACCGCCCAAGAGCACGCCATCGCTCAAGGATTATTCTTATGAGCAGGTTTGGGAGATGCATCCCGAC
CAGTTCCAGGAGTTTGCCGAAGTATTGAAAAAGAAGGCTGTCCAGAAGCCGAGTGAAGAGAATGTGAAGG
AGTACTTCGAGGTCCAGGAGATTGCCCGCAAGAAGGCGCTGGCTTTTTCCAACGTGGCTCAGTTTGTCTG
GCAGAAGTACCCGGAGCTGACCACCAAGAAGGACTATCCGATCACGACTCCCGGCAACCTGGCGAGGATC
TCCCAGATCAATGAGGAGCGGCAGCGCATTCTGCGGGACAACCGGGATGACTTTGCCCTGATTTATTTCC
AGAGACCTGACTGCAGCTACTGCGATGAGCAATCCCGCATCCTTGACTGGTTCACCAACGAGACCGGCTG
GACCGTGAAGAAGGTCAACATCAGTGAGAACCCGGGACTCGCCGCCAAATTCAGCGTGGAGATCACGCCG
ACCCTGATCCTGATCCAGAAAGGGAACCAGGATTATCTACCGGTCTCGGCAGGCGTCATTTCCGCCGACG
AGATCGAAGACAAGGCATACCGGGCCGTGCGCCTCCTCAAGGGTGACATCTCCCCGGAGGAATATTCGCT
CTACGAATTCCAGAAGGGAGGCAGTTTCGACGTGAAGAAACGCCGTCTTCAGGAGGAGCGGCCATGA
 Primer design