SecReT4
Protein ID: 189423325
T4SS name [ID]Tra_F [601]
Gene symbol-
Locus tagGlov_0253
StrainGeobacter lovleyi SZ
Repliconchromosome [GenBank: NC_010814] [Browse all T4SS(s) in this replicon]
Location [Strand]232134..233660 [+]
Producthypothetical protein
Component typeTraH_F
UniProt IDB3EAZ8
KEGG IDglo:Glov_0253
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 6.2e-94, Aligned region: 44..403
Protein Sequence: 508 a.a.     [Download]
>gi|189423325|ref|YP_001950502.1| hypothetical protein Glov_0253 [Geobacter lovleyi SZ]
MSLPVPLQQKRGVSVKRTVITRTAAACLAATIALNPVLSWSGWVDDWVQQKSSTSPSYYEGSKRGYYTGG
SFSARWANTDDHLFTASLPKLKSGCGGIDMFLGGFSFLNVDYLVQKLQNILSAAPAAAFDIALKTLAPQV
ADTIKSLEAITDRLNSLQMNDCKAAKALVATAASPFSSVMSDSLKAEMKTAQTDFMVSSGAKDLYQDVSK
LFESEQKTNAGNKPGVPGTTQTSATSATAGCPTEVLQVFGDGSVLENLAGKKGMSSEYVKLVRGFIGDVI
IQNPATTGTTYQAQYIPPCDKNNSFDSFISGSAQGRDTAGACADITDANKNLMVYVAGKMQSIATKIKSK
TALTADEEAFLKSTPLSVGLILKNATATNTEGEVIGKLAELTARAYGYYMLLDLFGRAVQLQEMARNIMS
TQKGNKAGASPETCQLALLGEGMQHIQTLEEKTLQLLSVAQQSYANAASEINAVEMIVQNMKKFDDTVFS
ELSDRFGKGIAMRATGRI
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|189423082|ref|NC_010814.1|:232134-233660 Geobacter lovleyi SZ chromosome, complete genome
ATGAGTCTGCCGGTACCACTGCAACAGAAAAGAGGTGTCAGTGTGAAACGAACTGTTATTACCAGAACCG
CCGCTGCCTGCCTGGCGGCAACAATTGCCTTGAACCCTGTTCTTTCCTGGTCCGGCTGGGTCGATGACTG
GGTGCAGCAAAAAAGCTCCACTTCTCCCAGCTATTATGAAGGATCAAAGCGTGGCTACTACACTGGCGGC
AGTTTCTCTGCCAGATGGGCGAACACCGATGACCATCTGTTTACTGCCTCGCTGCCCAAACTGAAGTCCG
GCTGCGGTGGGATCGACATGTTTCTCGGCGGCTTCTCGTTTCTGAATGTGGATTACCTGGTGCAGAAGCT
CCAGAACATCCTGTCGGCAGCTCCGGCCGCAGCCTTTGATATTGCCCTGAAAACCCTGGCACCCCAGGTT
GCCGATACCATCAAGAGTCTTGAAGCAATCACCGACCGGTTGAACTCGCTACAGATGAATGACTGCAAGG
CGGCCAAGGCTCTAGTGGCTACTGCTGCCAGTCCGTTTTCATCAGTCATGTCCGACAGCCTGAAGGCAGA
GATGAAAACAGCCCAGACCGACTTCATGGTATCAAGCGGCGCCAAGGATCTTTATCAGGATGTCAGCAAG
CTGTTCGAGAGCGAACAGAAGACCAATGCTGGTAACAAGCCTGGCGTTCCCGGAACGACCCAGACCTCAG
CCACCAGTGCTACCGCCGGTTGCCCGACCGAAGTCCTGCAGGTATTCGGGGACGGGTCGGTCCTGGAAAA
CCTGGCCGGCAAGAAAGGAATGAGCAGCGAGTACGTCAAACTGGTGCGCGGCTTCATCGGCGATGTGATC
ATCCAGAACCCGGCGACGACCGGTACCACCTACCAGGCCCAATACATTCCTCCGTGCGACAAGAACAACA
GCTTCGATTCCTTTATCAGCGGTTCCGCCCAGGGACGGGATACCGCCGGGGCCTGTGCCGATATTACCGA
TGCCAACAAGAACCTGATGGTCTATGTGGCCGGCAAGATGCAGTCCATCGCTACCAAGATCAAATCGAAG
ACCGCCCTTACCGCCGACGAGGAGGCGTTCCTCAAGAGTACGCCGCTGTCGGTCGGGCTGATCCTCAAGA
ATGCCACTGCCACCAATACCGAGGGTGAGGTCATCGGCAAACTGGCAGAACTGACCGCCCGGGCCTACGG
CTACTACATGCTGCTCGACCTGTTTGGGCGTGCAGTCCAGTTGCAGGAGATGGCCCGCAACATCATGTCT
ACCCAGAAGGGTAATAAAGCCGGGGCTTCGCCGGAGACCTGCCAGTTGGCGCTCCTCGGCGAAGGTATGC
AGCATATCCAGACGCTTGAGGAAAAGACGCTGCAACTTCTGAGCGTTGCCCAGCAGAGTTACGCCAATGC
AGCTTCTGAGATCAATGCGGTGGAAATGATCGTCCAGAATATGAAGAAATTCGACGACACAGTGTTTTCG
GAATTATCAGACCGGTTCGGCAAAGGAATCGCCATGAGGGCTACCGGCAGAATCTAA
 Primer design