SecReT4
Protein ID: 189423382
T4SS name [ID]Tra_F [601]
Gene symbol-
Locus tagGlov_0311
StrainGeobacter lovleyi SZ
Repliconchromosome [GenBank: NC_010814] [Browse all T4SS(s) in this replicon]
Location [Strand]283987..285009 [-]
ProductTraU family protein
Component typeTraU_F
UniProt IDB3EB55
KEGG IDglo:Glov_0311
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.4e-57, Aligned region: 32..335
Protein Sequence: 340 a.a.     [Download]
>gi|189423382|ref|YP_001950559.1| TraU family protein [Geobacter lovleyi SZ]
MNLSNNITIIALVTLFLTVPVAYGAGGACKGKVLNPVTDICWQCMFPVKMGSVSYGNGAEPAPGNVTSPV
CACPDSKGILILGVSTAFWEHARLIETVKDPFCFPVMGTGMTNPKPGFSSGENRSKEYGDSDFAFQQAHY
FYFPAWSILKLFMDFPCAENRAFDLAYMTEVDPMWNDDSLSFIINPEALLFGNPVSQLACVADSVAATVT
YPIDPLFWCMGSWGSFYPLSGSMIENNPLNVNAGLAARMLFKLGRETLLYDTGINQCASAGVVTPILVKS
NYRLQIARPVRGNDCIPIGRPSLIWGAAKNPPFGTTNTSPDNFLWSLTRRRVCCVGYALN
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|189423082|ref|NC_010814.1|:c285009-283987 Geobacter lovleyi SZ chromosome, complete genome
ATGAACCTGAGCAATAACATAACTATCATCGCATTGGTCACGCTCTTTCTAACAGTACCGGTTGCCTACG
GGGCAGGCGGTGCCTGCAAGGGTAAGGTGCTCAACCCGGTGACCGATATTTGCTGGCAGTGCATGTTCCC
GGTGAAGATGGGGAGCGTCTCCTACGGCAATGGCGCCGAACCGGCTCCCGGCAACGTCACTTCACCGGTC
TGTGCCTGTCCGGACAGCAAAGGGATTTTGATCCTTGGGGTCTCTACGGCTTTCTGGGAGCATGCCCGTC
TGATCGAAACGGTCAAGGACCCGTTCTGTTTCCCGGTCATGGGCACCGGCATGACCAATCCGAAGCCCGG
CTTCTCTTCTGGTGAGAATCGGAGCAAGGAGTACGGCGATTCGGACTTCGCCTTCCAGCAGGCCCATTAC
TTCTACTTCCCAGCCTGGTCGATCCTGAAACTGTTCATGGATTTTCCCTGCGCGGAGAACCGGGCGTTCG
ACCTGGCCTATATGACGGAAGTTGATCCCATGTGGAACGATGACAGTCTGTCGTTCATCATCAACCCGGA
GGCGCTCCTGTTCGGTAATCCGGTTTCGCAGTTGGCGTGCGTTGCCGACAGTGTAGCGGCAACTGTGACG
TATCCGATTGATCCCCTGTTCTGGTGCATGGGGAGCTGGGGCTCTTTCTATCCCCTGTCAGGGAGTATGA
TCGAGAATAATCCCCTCAACGTGAATGCTGGTCTGGCGGCCCGGATGCTGTTCAAGCTCGGTCGTGAAAC
ACTCCTCTATGATACCGGCATCAACCAGTGCGCCAGTGCCGGAGTCGTGACACCGATTCTCGTCAAAAGT
AATTACCGTCTCCAGATAGCTAGACCGGTACGTGGCAACGACTGCATACCCATTGGCAGGCCGTCACTGA
TTTGGGGGGCTGCGAAGAATCCACCCTTCGGCACAACCAACACCTCACCGGATAATTTTCTCTGGTCACT
GACACGAAGGAGGGTCTGTTGCGTCGGCTATGCACTCAATTGA
 Primer design