SecReT4
Protein ID: 189423384
T4SS name [ID]Tra_F [601]
Gene symbol-
Locus tagGlov_0313
StrainGeobacter lovleyi SZ
Repliconchromosome [GenBank: NC_010814] [Browse all T4SS(s) in this replicon]
Location [Strand]285460..286116 [-]
Producthypothetical protein
Component typeTraW_F
UniProt IDB3EB57
KEGG IDglo:Glov_0313
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 218 a.a.     [Download]
>gi|189423384|ref|YP_001950561.1| hypothetical protein Glov_0313 [Geobacter lovleyi SZ]
MIRRTGLAVIALVLGISSAQAKVIGTYGTTYRITERDALAEIEERARQVDWNKVLDKRKIENYQGPPDKA
SLPRAMRNRSFPVDMTYATEIDVPDGKGGILYPKGYTFNPLDYVTYPKTLVVINGTDPDQVKWFAASEYD
KRLDVTLLLTEGSFGAVSKRISRPLFYADRKIIERLKLQAVPSVIKQKGRLMEITEVALPVGKTKAAARS
SQNRKGTP
 
Nucleotide Sequence: 657 bp     [Download]
>gi|189423082|ref|NC_010814.1|:c286116-285460 Geobacter lovleyi SZ chromosome, complete genome
ATGATCAGGCGCACAGGATTGGCAGTGATAGCGCTGGTGCTTGGTATTTCGTCGGCGCAAGCCAAGGTGA
TTGGTACTTACGGAACCACGTACCGAATCACGGAGCGGGATGCCCTGGCCGAGATCGAAGAACGGGCCCG
GCAAGTGGACTGGAACAAGGTGCTGGACAAGCGCAAGATCGAGAATTACCAGGGACCACCGGACAAGGCG
AGTCTGCCGCGAGCAATGCGGAACCGGAGCTTCCCGGTTGACATGACCTATGCCACTGAGATCGACGTAC
CAGACGGCAAGGGAGGGATTCTTTACCCCAAGGGTTACACCTTCAACCCGCTCGATTACGTGACCTATCC
GAAAACGCTGGTTGTCATCAACGGCACTGACCCGGATCAGGTGAAGTGGTTTGCTGCCTCCGAATATGAC
AAGCGACTCGATGTAACGCTCCTCCTGACCGAGGGGAGTTTCGGGGCCGTATCGAAGCGGATCAGCCGTC
CATTGTTCTATGCCGACCGGAAGATAATCGAACGACTGAAACTGCAGGCCGTGCCATCGGTCATCAAACA
GAAGGGACGTTTGATGGAGATAACTGAAGTGGCGCTGCCGGTTGGTAAGACAAAGGCAGCGGCCAGATCG
TCACAAAACAGGAAAGGAACCCCATGA
 Primer design