SecReT4
Protein ID: 189423385
T4SS name [ID]Tra_F [601]
Gene symbol-
Locus tagGlov_0314
StrainGeobacter lovleyi SZ
Repliconchromosome [GenBank: NC_010814] [Browse all T4SS(s) in this replicon]
Location [Strand]286113..289487 [-]
Producthypothetical protein
Component typeTraN_F
UniProt IDB3EB58
KEGG IDglo:Glov_0314
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 4.1e-14, Aligned region: 993..1076
Protein Sequence: 1124 a.a.     [Download]
>gi|189423385|ref|YP_001950562.1| hypothetical protein Glov_0314 [Geobacter lovleyi SZ]
MLFRIAYSVLYAVLLLSLSGVTTTAQAVVSCQDSITTGTTYRYSDALAFFTEFNGKTYAIAKSAVSGSQS
LPDIYFDFSANISREYLMTGTDTASLKRMLSLGQFGAAKPVSVDSQQTLDFLIKRYGAYLGTATSDKSTY
IDAWKEFGPVGFNAIDGSGLPFTKWPAAGAYTGQDPQAVVMGSDGIWSSGLDGTRSSQIVEFSGKLDCAL
SYIDPGTITPPPPPPPPPPPDPNAINNIMCGQDLNNNGYAGDPGETANCIQTTQGQFCPVGSTECVETFT
APVCPAGSTLETTRDMCQATAQNVCGSGYTWDSGIDKCIKAVTCPENGTFNPVADRCEKLVQNDCPVGYS
YDANPASQTYDRCVKSATCTDGGAFIAAKDRCEKAWMPVCDTANGYAYNGSTGKCERSPICTYGSYNASY
NLCVQPFVPSCPGGYSYNSSRGRCEKAPECPAGTTYNVVTNKCDAITGASAQQVLSCSPQSFLCAPYADS
CCNVSISCPNGPQGQVNVAANYCCLGSDAITIQSPLSLLARTELTSTGYALSALQCDSVGNCSYYFMDRY
CADGSPASDWMLSGAFTMASTQMVCPAGQALINGNQCLSATNPTCSGGNFDPNMDVCWAAYTPTCTQGTY
DSASGLCILVPSCPNGTLNTTTDLCEATITRDCGTYSFDAAANLCFSSPVCANGAYDASLNVCQATLTRN
CGTYGWSQADFKCLQPVTCPKDPTFSQAATTTFSTTLDKCVSEVQHDCPAGTTYTPFPIGKCEAVPICSA
AGIYNPQKDSCFEGFNTCPLGTQYACMEYQNKMQCSPNPCFNPGAPGSEVTTTLDESMLQDDGPKDANGN
CLGQIYIFNGKASRCRPPGMTVGYLNNCCESDKVASEDTGSSISTAVQGIQMAYEIGQVAYYGNALVTGA
AQISAISTTATGAVTSMTVVSAAGTTTTLSGAAATGAYATMASGATGASALGAGLQAYAAALFNPATIII
AVVVLVVMKVLMGSGCDQGDIQTGMQKEGKQCHYVGDYCQKKWPLVGCVQKAKSFCCFNSKMARIIHEQG
RPQLQSFQPNGGWGVPEAPNCRGFTPDEFQALDFSRIDLSEYFEDVQKDLATKIDGSQQTIMQNIQNKYQ
ATPK
 
Nucleotide Sequence: 3375 bp     [Download]
>gi|189423082|ref|NC_010814.1|:c289487-286113 Geobacter lovleyi SZ chromosome, complete genome
ATGCTATTCCGTATTGCCTACTCAGTTCTCTATGCCGTTCTCCTGCTCTCCCTTTCCGGAGTAACCACCA
CGGCTCAGGCCGTTGTCAGTTGCCAGGACTCCATCACCACGGGTACCACCTATCGTTACAGTGATGCCCT
GGCGTTCTTCACCGAATTCAACGGCAAAACCTACGCCATCGCCAAATCAGCTGTCAGTGGCAGCCAGTCG
CTTCCCGACATCTATTTCGACTTTTCGGCGAATATCAGCCGTGAGTACCTGATGACCGGTACCGACACGG
CCTCGCTCAAGAGGATGTTGTCTCTTGGACAGTTCGGGGCGGCCAAGCCGGTCAGTGTGGACAGCCAGCA
GACACTGGATTTCCTGATCAAGCGCTATGGCGCGTATCTGGGGACAGCAACCTCGGATAAGAGCACCTAC
ATTGACGCCTGGAAAGAGTTCGGGCCTGTCGGATTCAACGCCATTGACGGATCGGGACTTCCATTCACGA
AGTGGCCGGCTGCTGGCGCCTATACCGGACAGGACCCGCAGGCAGTCGTCATGGGTAGTGACGGGATTTG
GTCCAGCGGTCTCGATGGGACAAGAAGCTCACAGATCGTCGAATTTTCCGGCAAGCTCGACTGTGCCCTG
TCGTACATTGATCCCGGCACGATCACTCCGCCACCGCCGCCACCTCCCCCGCCACCACCTGATCCCAATG
CCATCAACAACATCATGTGCGGTCAGGATCTGAATAACAACGGCTATGCCGGTGACCCGGGAGAAACAGC
CAACTGCATTCAGACGACTCAAGGACAATTCTGCCCGGTCGGTTCCACGGAATGCGTTGAAACCTTTACC
GCACCAGTCTGTCCGGCTGGCTCTACTCTGGAGACAACTCGTGACATGTGTCAGGCCACAGCCCAGAACG
TGTGCGGCAGCGGCTACACCTGGGACTCTGGTATCGACAAATGCATCAAGGCAGTGACCTGTCCGGAAAA
CGGAACCTTCAATCCGGTTGCCGACCGCTGTGAGAAACTGGTTCAAAACGATTGTCCCGTTGGCTATTCC
TATGACGCCAACCCGGCCAGTCAGACCTACGACCGTTGTGTGAAGTCGGCAACATGCACTGACGGAGGAG
CGTTCATTGCGGCAAAAGATCGGTGCGAAAAAGCATGGATGCCGGTCTGCGACACTGCCAATGGCTACGC
CTACAACGGTTCGACAGGCAAGTGCGAACGGTCGCCTATTTGTACCTATGGCAGCTACAACGCCTCGTAC
AATCTCTGCGTCCAACCCTTCGTGCCATCTTGTCCGGGAGGCTACAGCTATAACAGTTCCCGGGGGCGCT
GCGAAAAAGCTCCCGAATGCCCGGCAGGCACCACGTACAATGTGGTCACAAACAAATGTGACGCCATCAC
CGGTGCCAGCGCACAACAGGTTTTATCCTGCAGTCCTCAATCGTTTCTTTGCGCACCTTATGCAGACTCC
TGCTGCAATGTAAGTATCTCCTGCCCCAATGGCCCCCAGGGGCAGGTGAATGTTGCTGCAAATTACTGTT
GCCTCGGCTCTGACGCTATTACGATTCAGTCCCCCCTCAGTCTCTTGGCAAGAACCGAGCTGACCAGTAC
CGGTTACGCTCTGTCGGCGTTGCAATGCGATAGCGTCGGCAATTGCAGCTACTACTTCATGGATCGTTAT
TGTGCCGATGGGTCACCGGCAAGTGATTGGATGTTATCCGGGGCATTCACGATGGCTTCGACTCAGATGG
TCTGTCCTGCCGGTCAGGCTCTCATCAATGGTAATCAGTGCCTTTCTGCAACTAACCCGACCTGTTCAGG
CGGCAACTTCGACCCAAACATGGATGTCTGCTGGGCCGCTTATACGCCAACCTGCACCCAGGGAACCTAT
GACAGCGCCAGCGGGCTGTGTATTCTTGTGCCTTCCTGTCCGAACGGCACCCTAAACACCACAACTGACC
TCTGCGAAGCAACCATTACCAGGGACTGCGGCACCTACTCCTTTGATGCTGCCGCCAATCTCTGCTTCTC
GTCGCCGGTATGCGCCAATGGTGCTTATGACGCGAGCCTCAACGTCTGCCAGGCCACGCTGACCCGCAAT
TGCGGCACCTACGGCTGGAGTCAGGCTGACTTCAAGTGCCTTCAACCTGTTACCTGTCCCAAGGACCCAA
CCTTCTCCCAGGCCGCTACCACTACTTTTTCAACCACGCTTGATAAGTGCGTTTCCGAAGTCCAGCACGA
CTGCCCGGCGGGAACAACATACACACCGTTTCCCATCGGCAAGTGCGAGGCGGTGCCGATTTGCAGCGCC
GCCGGTATCTACAATCCGCAGAAGGACAGCTGCTTCGAGGGGTTCAATACCTGTCCGCTCGGGACTCAGT
ATGCTTGCATGGAATACCAGAACAAGATGCAGTGCTCCCCGAACCCCTGTTTCAATCCTGGAGCGCCCGG
GTCTGAGGTGACGACCACTCTCGACGAGTCAATGCTTCAGGATGACGGGCCGAAAGATGCAAATGGCAAT
TGTCTCGGCCAGATCTACATCTTCAACGGAAAAGCGTCGCGTTGCCGTCCCCCCGGTATGACGGTCGGGT
ACCTCAACAACTGCTGCGAGAGCGACAAGGTGGCTTCGGAAGATACCGGCAGCAGCATCTCGACAGCGGT
TCAGGGCATTCAGATGGCCTATGAAATCGGTCAGGTCGCCTATTACGGCAACGCACTTGTGACCGGTGCT
GCGCAGATTTCGGCGATATCTACCACTGCTACCGGTGCAGTCACCTCCATGACAGTTGTATCCGCTGCCG
GAACTACCACGACCCTGTCAGGAGCGGCAGCAACAGGTGCATACGCAACCATGGCCAGCGGAGCGACAGG
AGCTTCTGCCCTTGGAGCCGGATTGCAGGCATATGCCGCTGCCCTGTTCAACCCAGCCACCATTATCATC
GCAGTAGTCGTCCTGGTAGTAATGAAAGTGCTGATGGGAAGCGGATGTGATCAGGGTGACATTCAGACCG
GGATGCAGAAAGAAGGCAAACAGTGCCACTACGTGGGGGACTACTGCCAGAAGAAATGGCCGTTGGTGGG
ATGTGTGCAGAAGGCCAAGAGTTTCTGCTGCTTCAACTCGAAAATGGCGAGGATCATACATGAACAAGGG
AGACCGCAACTGCAATCATTTCAGCCGAACGGCGGCTGGGGTGTACCAGAAGCACCCAACTGCCGCGGCT
TTACGCCAGACGAATTCCAGGCACTGGATTTTTCGAGGATCGATCTTTCGGAATACTTCGAAGACGTACA
GAAGGATCTTGCTACCAAGATTGATGGTTCACAACAGACCATCATGCAAAACATCCAGAACAAGTACCAG
GCGACGCCGAAATGA
 Primer design