SecReT4
Protein ID: 189423387
T4SS name [ID]Tra_F [601]
Gene symbol-
Locus tagGlov_0316
StrainGeobacter lovleyi SZ
Repliconchromosome [GenBank: NC_010814] [Browse all T4SS(s) in this replicon]
Location [Strand]291453..293900 [-]
Productsex pilus assembly protein
Component typeTraC_F
UniProt IDB3EB60
KEGG IDglo:Glov_0316
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 4.1e-50, Aligned region: 25..244
AAA_10 [PF12846], Evalue: 8.4e-48, Aligned region: 442..729
DUF87 [PF01935], Evalue: 1.4e-06, Aligned region: 433..573
Protein Sequence: 815 a.a.     [Download]
>gi|189423387|ref|YP_001950564.1| sex pilus assembly protein [Geobacter lovleyi SZ]
MGVASALFGSGGGFTRSELRRLTERDNFSEYFPWIAHDPKNQIYLNTDNTFGMMWECAPLAFACETTIRT
LEGLFRVNLPDGSIMQFILFADPFVNQIVDTYTSMKLRDSKLVRDVSDNVSRFFQEGVEGLGCLSGIPIR
NFRMFFTVKFPVKDSAHVNLDEVFGTIQEVLRGAGLSPVVVNPGNLLDWLRRMLNEDPSANSSHYDDRNI
IRKQVLLGTKVEKRFSSLKFGSRHFRCVTPKSFPLNGDPIQTNQLFGGIMGMATDSDQIRTPFFFTLNIV
LRNQKNKLHTKCNMVLQQQGVGSFAPSLARKKDEYLWAVDELERGTKFYRVIPIMWVYGSDEWLVNESVT
RAKRVWEGQGYVMQEDKGILPILFISSLPFGLYDHGSNIDTLDRDHILPVDSIAVMLPVQGDFSGLGKPV
MLFAGRKGNLFGLDIFNKGVNNHNAMVCASSGAGKSFFINYLVYNYFAMKSKIRIIDIGGSYKKMTKLFG
ARYLDFSEDSQVCLNPFTNIIDPEYDIPVIAPIVAQMVFSTGKTIPSETEMTLIKGAVRWAWQQKGNDAD
IDTVHEYLFNFDRYSSEGGEIKEAASRLAFNLADFKSDGTFGRFFNGKSNLDISNDEFVVLELEHLKSRK
ELFRVVTLQVINAVTQDLYLSDKSDQRLIVFDEAWQFLGESSTLKEVIEEGYRRARKYHGSFTIITQSVL
DMKLFGGVGDVIRNNSAFKFYLESSDFEKALDEKLMDYDDFTMRILKSTKSNKPKYSEIFMDTPFGVGVG
RLAVDPFSYYVFTSDASEITEIEAMVDGGVSYEDAIREMVKKYRS
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|189423082|ref|NC_010814.1|:c293900-291453 Geobacter lovleyi SZ chromosome, complete genome
ATGGGAGTAGCGTCAGCGTTGTTTGGAAGTGGAGGAGGCTTCACCAGGAGCGAATTGCGCCGCCTCACCG
AACGGGACAATTTTTCCGAATATTTCCCGTGGATTGCCCATGACCCCAAGAATCAGATCTATCTGAACAC
TGACAACACCTTCGGGATGATGTGGGAGTGTGCTCCCCTGGCTTTTGCCTGTGAGACTACCATCAGGACT
CTGGAGGGGTTGTTCCGTGTAAACCTGCCTGATGGCTCGATCATGCAATTCATCCTGTTTGCCGACCCCT
TTGTGAATCAGATTGTGGACACTTACACTTCCATGAAATTGCGCGACAGCAAACTGGTACGCGATGTTTC
TGACAACGTGTCCCGATTCTTTCAGGAAGGTGTGGAAGGCCTCGGCTGTCTGAGCGGTATTCCGATCCGA
AACTTCAGGATGTTTTTTACGGTCAAGTTTCCGGTGAAGGATAGTGCTCATGTAAATCTTGATGAAGTGT
TCGGAACAATCCAGGAAGTGCTGCGTGGCGCCGGCTTATCACCGGTTGTTGTCAATCCGGGGAACTTGCT
GGATTGGCTGAGACGCATGCTGAATGAGGACCCGTCTGCAAATAGCAGTCACTATGATGATCGCAATATC
ATCCGCAAGCAGGTGCTGCTCGGGACCAAGGTAGAGAAAAGGTTCTCTTCTCTCAAGTTCGGTTCCCGAC
ACTTCCGCTGCGTCACCCCGAAGTCATTCCCTCTGAATGGCGACCCGATCCAGACCAACCAACTCTTTGG
TGGAATCATGGGGATGGCTACCGATTCCGATCAGATCCGGACGCCATTCTTCTTTACGCTGAATATCGTC
CTGCGGAACCAGAAGAATAAACTCCACACCAAATGCAACATGGTCCTGCAGCAGCAGGGTGTCGGCAGTT
TCGCCCCATCGCTGGCCAGAAAGAAAGACGAGTACCTCTGGGCGGTCGATGAACTGGAACGGGGCACCAA
ATTCTACCGGGTAATTCCTATCATGTGGGTCTACGGCAGCGACGAATGGCTGGTAAATGAGTCCGTCACC
AGGGCCAAGCGGGTCTGGGAGGGCCAAGGGTATGTCATGCAGGAGGATAAGGGGATTCTTCCCATCCTGT
TCATCTCTTCCCTGCCATTTGGTCTCTACGACCACGGCAGCAACATCGACACTCTTGACCGGGACCATAT
TCTCCCCGTCGACAGTATCGCCGTGATGTTACCGGTGCAGGGGGACTTCTCCGGACTGGGCAAACCGGTA
ATGCTCTTCGCCGGACGCAAGGGAAATCTATTCGGTCTCGACATCTTCAACAAGGGAGTCAACAACCACA
ACGCCATGGTCTGCGCCTCCAGCGGCGCCGGCAAAAGCTTCTTTATCAACTATCTGGTCTACAACTACTT
CGCCATGAAATCGAAGATCCGGATCATCGACATCGGCGGGTCCTACAAGAAGATGACCAAACTGTTCGGT
GCCCGCTACCTGGACTTCAGCGAAGACTCCCAGGTGTGCCTGAACCCCTTCACCAACATCATCGATCCCG
AGTACGACATCCCGGTTATCGCTCCCATCGTTGCCCAGATGGTCTTTTCTACCGGAAAAACCATCCCCAG
CGAGACAGAGATGACCCTCATCAAAGGAGCGGTTCGCTGGGCCTGGCAGCAGAAGGGCAACGATGCAGAT
ATCGATACCGTCCACGAGTACCTGTTCAATTTCGACCGCTACTCGTCAGAGGGTGGCGAGATCAAGGAGG
CTGCTTCCCGGCTTGCCTTCAACCTGGCCGACTTCAAGAGCGACGGAACATTTGGCCGTTTCTTCAACGG
CAAAAGCAATCTCGACATCTCCAATGATGAGTTCGTGGTGTTGGAACTGGAGCACCTCAAGTCCCGTAAG
GAATTGTTCCGGGTAGTCACCCTTCAGGTGATAAATGCCGTAACCCAGGATCTCTATCTCTCAGACAAGT
CTGATCAGCGACTGATCGTTTTTGATGAGGCATGGCAATTCCTTGGAGAGAGTTCGACCCTGAAGGAGGT
CATTGAGGAAGGGTACCGTCGTGCCCGCAAATACCATGGCAGTTTCACCATAATCACCCAGTCGGTACTC
GACATGAAGCTCTTCGGCGGAGTTGGCGATGTCATCCGGAATAACTCGGCCTTCAAATTCTATCTGGAGT
CGTCCGACTTCGAGAAGGCGCTGGACGAGAAGCTGATGGACTACGACGATTTTACCATGCGGATTCTCAA
GTCAACGAAGAGCAACAAGCCCAAGTACTCGGAGATCTTCATGGACACTCCTTTCGGCGTCGGAGTCGGC
AGATTGGCCGTAGATCCTTTCTCCTACTACGTCTTCACGTCTGATGCGAGCGAGATAACTGAAATAGAGG
CAATGGTTGATGGCGGAGTGAGTTATGAGGATGCAATCCGTGAGATGGTCAAGAAATACCGCAGTTAG
 Primer design