SecReT4
Protein ID: 189423388
T4SS name [ID]Tra_F [601]
Gene symbol-
Locus tagGlov_0317
StrainGeobacter lovleyi SZ
Repliconchromosome [GenBank: NC_010814] [Browse all T4SS(s) in this replicon]
Location [Strand]293903..294397 [-]
Producthypothetical protein
Component typeTraV_F
UniProt IDB3EB61
KEGG IDglo:Glov_0317
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 9.5e-19, Aligned region: 23..152
Protein Sequence: 164 a.a.     [Download]
>gi|189423388|ref|YP_001950565.1| hypothetical protein Glov_0317 [Geobacter lovleyi SZ]
MKKALITIGMLTMSGCALLNPYESSFSCPETSNGKCVSVQTAYKESTASPGKSSEAPAEHKEDDCNADNA
AAGLCTEGKKDISLHPSAKENGTYNRYQSALFDKFSGLLKEPVTPVVAPPKTMRVLLLPYTGQDNEFYML
RYVYFFVDEPRWLMGDSVTSGEEE
 
Nucleotide Sequence: 495 bp     [Download]
>gi|189423082|ref|NC_010814.1|:c294397-293903 Geobacter lovleyi SZ chromosome, complete genome
GTGAAGAAAGCCCTTATTACTATAGGAATGCTGACAATGAGCGGCTGTGCCCTGCTCAACCCCTACGAAA
GCAGCTTTAGCTGCCCTGAAACCAGCAACGGCAAGTGCGTTTCGGTGCAAACCGCCTACAAGGAATCGAC
AGCAAGTCCTGGCAAATCAAGCGAAGCACCTGCAGAACACAAGGAAGACGATTGCAATGCTGACAATGCA
GCAGCCGGTCTCTGCACCGAAGGCAAGAAGGATATCTCCCTGCATCCGTCGGCCAAAGAGAACGGTACCT
ACAACCGCTACCAATCGGCACTGTTCGACAAATTCAGCGGACTCCTGAAGGAACCGGTCACACCGGTTGT
TGCACCCCCGAAAACCATGCGAGTGCTCCTTCTGCCATACACCGGCCAGGACAATGAATTCTACATGCTG
CGCTATGTCTACTTCTTCGTTGATGAACCGCGCTGGTTGATGGGTGACTCCGTTACATCCGGCGAGGAGG
AGTAG
 Primer design