SecReT4
Protein ID: 189423389
T4SS name [ID]Tra_F [601]
Gene symbol-
Locus tagGlov_0318
StrainGeobacter lovleyi SZ
Repliconchromosome [GenBank: NC_010814] [Browse all T4SS(s) in this replicon]
Location [Strand]294394..295662 [-]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDB3EB62
KEGG IDglo:Glov_0318
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.7e-40, Aligned region: 211..411
Protein Sequence: 422 a.a.     [Download]
>gi|189423389|ref|YP_001950566.1| TraB pilus assembly family protein [Geobacter lovleyi SZ]
MKNKLLSFWNGLSGSQRRNLVWIMTGCILVAVFTIGYYVMNKGKDPALNKSVKQTPLSIEPKLLEKSQFL
ESQKEIAKRDDKVAELTKKLDEITREKKGDPTTAPVAQIGTAPAVPGDNHAQQQGQLQKTGSGRTAISKQ
PLPPIPPMPQGSSISLPPPPATAQGIAAGQLQSPTETEIGDIAIVSSPGSGKSAKADVDDKKKDVGTVQV
YLPPSFMEATLLSGLDAPTTSEAKGNPVPVLLRVKTPAVLPNSVKANLKGCFVIADGKGNLATERAELLL
VSLSCLDRKGQAVVDQKIKGFVVDEDGKIGLRGRVVAKMGSMIARSMLAGFFGGAGDAIKSAATTMSVSP
LGTTQTVDPKDIAMSGLGSGLSSGFKEIQKFYMELARQTMPVIEVGATKPVTLVISEGINLDIKKIAKGG
GK
 
Nucleotide Sequence: 1269 bp     [Download]
>gi|189423082|ref|NC_010814.1|:c295662-294394 Geobacter lovleyi SZ chromosome, complete genome
ATGAAAAATAAGCTCCTGTCTTTCTGGAACGGGCTAAGTGGCAGTCAGCGCCGAAATCTTGTCTGGATTA
TGACTGGCTGCATTCTGGTGGCAGTATTTACGATTGGCTATTACGTCATGAACAAAGGGAAAGATCCTGC
TCTCAATAAAAGTGTGAAGCAGACGCCCTTGAGCATCGAGCCAAAACTCCTTGAAAAGTCACAATTCCTT
GAAAGCCAGAAGGAAATTGCCAAGCGTGACGACAAGGTTGCCGAACTCACGAAGAAACTCGATGAGATCA
CCCGTGAGAAAAAGGGTGATCCGACTACAGCGCCGGTGGCTCAGATCGGCACAGCCCCCGCTGTACCGGG
AGACAATCATGCTCAGCAGCAGGGCCAATTGCAAAAAACCGGTTCTGGCAGGACAGCAATATCAAAACAA
CCGTTGCCTCCAATTCCACCGATGCCGCAAGGCAGCAGCATCTCGCTTCCCCCTCCGCCTGCCACAGCTC
AAGGAATTGCAGCAGGTCAGCTGCAGTCTCCAACCGAAACGGAAATCGGCGATATCGCCATCGTTTCGTC
TCCCGGATCAGGTAAATCAGCCAAGGCTGATGTGGATGATAAAAAAAAAGACGTCGGGACCGTCCAGGTT
TATCTGCCCCCTTCCTTTATGGAGGCGACTCTGTTGAGTGGCTTGGACGCTCCAACCACTTCGGAAGCCA
AAGGAAATCCGGTTCCGGTGCTGCTCAGGGTAAAGACTCCAGCGGTACTGCCCAATAGCGTCAAGGCAAA
CCTCAAAGGGTGCTTTGTTATCGCCGACGGCAAGGGGAACCTGGCAACCGAGCGTGCGGAACTGCTGCTC
GTTTCCCTGTCATGCCTCGACCGTAAGGGGCAGGCGGTGGTCGACCAGAAGATCAAAGGGTTCGTCGTTG
ATGAAGACGGCAAAATTGGCCTGCGTGGCCGGGTCGTTGCCAAGATGGGCTCTATGATCGCCAGGAGCAT
GTTGGCCGGTTTCTTCGGCGGTGCCGGTGACGCGATTAAGTCTGCGGCCACGACCATGTCCGTAAGCCCT
CTCGGTACAACACAAACCGTTGACCCCAAAGACATTGCCATGTCTGGGCTTGGGTCCGGCCTGTCGAGTG
GCTTCAAAGAGATCCAGAAGTTCTACATGGAACTGGCTAGGCAAACCATGCCGGTCATAGAAGTCGGAGC
CACAAAGCCTGTGACACTGGTCATCAGCGAAGGAATCAATCTGGACATCAAGAAAATTGCCAAGGGAGGC
GGAAAGTGA
 Primer design