SecReT4
Protein ID: 189423391
T4SS name [ID]Tra_F [601]
Gene symbol-
Locus tagGlov_0320
StrainGeobacter lovleyi SZ
Repliconchromosome [GenBank: NC_010814] [Browse all T4SS(s) in this replicon]
Location [Strand]296599..297177 [-]
Productpilus assembly protein
Component typeTraE_F
UniProt IDB3EB64
KEGG IDglo:Glov_0320
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1e-29, Aligned region: 1..182
Protein Sequence: 192 a.a.     [Download]
>gi|189423391|ref|YP_001950568.1| pilus assembly protein [Geobacter lovleyi SZ]
MNLDIFLQKSSNIFAENRLLKFVVVALGIAVVINTAGLFSALNSQRVILVPPTINSKISVSGDKASDEYL
KEFTRYILSLALTYNPVNVRSQFSELLAVYDPAEFQASRKELYELADKIENTKASSAFYIHSIINDAEKR
RLVVTGTKKTYMVDQKAEDVLKVYLIEYRFENGKFVLVRLYEKPAQGENKGA
 
Nucleotide Sequence: 579 bp     [Download]
>gi|189423082|ref|NC_010814.1|:c297177-296599 Geobacter lovleyi SZ chromosome, complete genome
GTGAACCTCGACATATTTCTGCAAAAAAGTTCCAACATATTTGCCGAGAACCGGCTGCTCAAATTCGTGG
TCGTAGCGCTCGGTATCGCCGTTGTTATCAACACTGCGGGCTTGTTCTCTGCCCTGAACAGTCAACGGGT
GATTCTCGTGCCGCCGACCATCAATTCAAAGATCTCGGTTTCAGGTGACAAAGCCTCGGATGAATATCTC
AAGGAATTCACACGCTACATCCTGAGTCTGGCGCTTACCTACAACCCGGTAAACGTCCGGTCGCAGTTCA
GCGAACTGCTGGCCGTCTACGACCCCGCCGAGTTCCAGGCATCACGTAAAGAGTTGTATGAACTGGCGGA
CAAAATCGAAAACACCAAGGCCTCCAGCGCCTTTTACATTCATTCAATCATCAACGATGCCGAGAAAAGG
CGACTGGTAGTGACCGGCACCAAGAAGACCTACATGGTGGATCAGAAGGCAGAGGACGTTCTGAAGGTCT
ACCTCATCGAATACCGCTTTGAAAACGGAAAATTCGTCTTGGTGCGTCTCTATGAGAAGCCAGCGCAAGG
CGAGAACAAGGGGGCGTGA
 Primer design