SecReT4
Protein ID: 189423392
T4SS name [ID]Tra_F [601]
Gene symbol-
Locus tagGlov_0321
StrainGeobacter lovleyi SZ
Repliconchromosome [GenBank: NC_010814] [Browse all T4SS(s) in this replicon]
Location [Strand]297200..297466 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDB3EB65
KEGG IDglo:Glov_0321
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.4e-07, Aligned region: 4..70
Protein Sequence: 88 a.a.     [Download]
>gi|189423392|ref|YP_001950569.1| hypothetical protein Glov_0321 [Geobacter lovleyi SZ]
MTRKFPQYLTQPFQVLWFEPDDLAIMTASFIFAQQFGGYLWLTMIIVPWAYSRFKRQYPRGFLRHILYFI
GLAPMKGYPQFFERDFLE
 
Nucleotide Sequence: 267 bp     [Download]
>gi|189423082|ref|NC_010814.1|:c297466-297200 Geobacter lovleyi SZ chromosome, complete genome
TTGACTCGCAAGTTTCCCCAATATCTGACGCAACCGTTCCAGGTCCTCTGGTTCGAGCCCGATGACCTGG
CAATCATGACGGCCAGTTTTATCTTCGCCCAACAGTTCGGTGGATATCTCTGGCTGACAATGATCATCGT
ACCATGGGCTTACAGCCGCTTCAAACGACAGTATCCACGTGGTTTTCTGCGCCACATACTCTATTTCATT
GGTCTGGCACCGATGAAGGGTTACCCGCAGTTCTTTGAAAGAGATTTTCTGGAATGA
 Primer design