SecReT4
Protein ID: 190014713
T4SS name [ID]Trb [251]
Gene symboltrbG
Locus tagpTiBo076
StrainAgrobacterium tumefaciens plasmid Ti plasmid pTiBo542 (NC_010929)
Repliconplasmid Ti plasmid pTiBo542 [GenBank: NC_010929] [Browse all T4SS(s) in this replicon]
Location [Strand]91801..92667 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA5WXZ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.3e-60, Aligned region: 72..285
Protein Sequence: 288 a.a.     [Download]
>gi|190014713|ref|YP_001967477.1| TrbG [Agrobacterium tumefaciens]
MAPNMNIRLRRFPATLTAAAMVAAILPFSASLSSRALGADGVTANEAKGMGISTQWRGSRGLVTKGPDGK
VIFLYGEVQPSVVCSPLQVCDIELQGGEVVRDVLVGDTVRWKVEPATSGAAEGQAIHLIVKPSEPNLVTS
MVVTTSRRTYHIQLKSHANQYMARVGFEYPEDVSTKLADINARMEASTIPGAGVPAERLNFSYSISGNAG
WRPTRVYSDGEKTYVQFPRSISGQDAPVLFVVSGGQNRIVNYRMKGDMMVVDYHVDRAVLVSGVGWKQEK
VTIRRGGR
 
Nucleotide Sequence: 867 bp     [Download]
>gi|190014640|ref|NC_010929.1|:c92667-91801 Agrobacterium tumefaciens Ti plasmid pTiBo542, complete sequence
ATGGCCCCGAACATGAACATTCGACTGAGACGTTTTCCGGCCACGCTGACTGCTGCCGCGATGGTTGCCG
CGATCTTGCCGTTTTCCGCTTCTCTTTCCTCCCGCGCGCTCGGAGCCGATGGCGTCACCGCCAATGAAGC
GAAGGGGATGGGGATTTCCACCCAGTGGCGCGGATCACGCGGACTTGTCACGAAAGGACCGGACGGGAAG
GTGATCTTTCTCTACGGCGAGGTCCAGCCCTCCGTGGTTTGCTCACCGCTGCAGGTCTGCGACATCGAGC
TTCAGGGCGGCGAGGTAGTCCGCGACGTGCTCGTCGGCGACACCGTAAGGTGGAAGGTGGAGCCAGCAAC
CTCGGGAGCGGCGGAAGGACAGGCGATCCACCTGATCGTCAAGCCGTCGGAGCCGAACCTCGTCACCTCG
ATGGTGGTGACGACCTCGCGCCGGACCTATCACATCCAGCTCAAGTCGCATGCAAACCAATACATGGCAC
GCGTCGGCTTCGAGTATCCGGAAGACGTTTCGACCAAGCTGGCCGACATCAACGCACGGATGGAGGCCAG
CACGATTCCCGGCGCCGGTGTTCCGGCCGAGCGGTTGAATTTCTCCTATTCCATCTCCGGCAATGCCGGC
TGGCGGCCGACAAGGGTCTATTCGGACGGGGAGAAGACTTACGTCCAGTTCCCGCGGTCGATCTCCGGCC
AGGACGCGCCGGTGCTGTTTGTCGTCTCCGGTGGGCAGAACCGCATCGTCAACTACCGGATGAAGGGCGA
CATGATGGTGGTCGACTATCACGTCGACCGCGCAGTGTTGGTCTCCGGCGTTGGCTGGAAACAGGAAAAG
GTGACGATCAGAAGGGGAGGGCGGTAA
 Primer design