SecReT4
Protein ID: 190014715
T4SS name [ID]Trb [251]
Gene symboltrbL
Locus tagpTiBo078
StrainAgrobacterium tumefaciens plasmid Ti plasmid pTiBo542 (NC_010929)
Repliconplasmid Ti plasmid pTiBo542 [GenBank: NC_010929] [Browse all T4SS(s) in this replicon]
Location [Strand]93350..94537 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA5WXZ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-31, Aligned region: 67..279
Protein Sequence: 395 a.a.     [Download]
>gi|190014715|ref|YP_001967479.1| TrbL [Agrobacterium tumefaciens]
MVIVSASRKLEFAFIAVAILALATAPAFAQQGAVLTTLENQVVTAAKGWETTVMNAARSLFWILAGIEVG
IAAVWLAINAASLDAWFAELVRRIMFIGLFAFILDGGPAFAKAVVDSLYQIGAGGGSASPANIFDAGIRV
ASKMSEQAKFGLFEDNALAIAAVFAMVVVVVAFSLVAAIFVAVMVEMYVGLLAGMIMLGLGGSSYTKDFA
VRYLVYAFSVGLKLMALVMIAKIGSDILLGLAEAPTATSDQFITTLAIAGISVVVFVIAMYVPPIMQGVV
QGASVGGGMEAIRHGGQAAATALGAGFLTIGAANRGFEAANAARAGGSSLAGAAMRGMEAAVGGAAGAVG
SAAKDKAIGSPGAYAGSLLGLANAKLDQTQKSGTPSAPPPINDKK
 
Nucleotide Sequence: 1188 bp     [Download]
>gi|190014640|ref|NC_010929.1|:c94537-93350 Agrobacterium tumefaciens Ti plasmid pTiBo542, complete sequence
ATGGTAATCGTCTCTGCTTCTCGTAAGCTGGAATTCGCCTTCATCGCCGTTGCGATCCTGGCTCTCGCGA
CCGCGCCGGCCTTCGCCCAGCAAGGGGCGGTCCTGACCACATTGGAAAACCAGGTTGTCACTGCCGCGAA
GGGCTGGGAGACGACGGTGATGAATGCGGCCCGATCGCTCTTCTGGATCCTCGCCGGCATCGAAGTCGGG
ATCGCCGCGGTCTGGCTGGCGATCAATGCGGCGAGCCTTGATGCCTGGTTCGCTGAACTTGTCCGCCGGA
TCATGTTCATTGGTCTGTTCGCCTTCATCCTCGATGGCGGTCCGGCCTTCGCCAAGGCCGTGGTCGACAG
TCTATATCAGATCGGCGCCGGCGGCGGCTCGGCTTCACCCGCCAATATTTTCGATGCCGGGATACGCGTC
GCCTCTAAAATGTCCGAGCAGGCGAAGTTCGGCCTGTTCGAAGACAACGCGCTCGCCATCGCAGCTGTCT
TTGCAATGGTCGTGGTTGTGGTCGCCTTTTCCCTGGTCGCCGCGATCTTCGTGGCAGTCATGGTCGAAAT
GTACGTCGGACTGCTGGCCGGCATGATCATGCTCGGGCTTGGCGGCTCGTCCTATACCAAGGATTTTGCC
GTCCGGTATCTGGTCTATGCCTTCTCCGTCGGCTTGAAACTGATGGCTCTGGTAATGATTGCCAAGATCG
GCTCCGACATTCTGCTTGGGCTTGCAGAAGCACCGACGGCAACCTCCGACCAGTTTATCACGACGCTTGC
CATCGCCGGCATCTCGGTCGTCGTCTTCGTCATCGCCATGTACGTGCCCCCTATCATGCAGGGTGTCGTC
CAGGGCGCGTCGGTCGGTGGAGGCATGGAAGCCATCCGTCACGGCGGGCAGGCGGCCGCTACCGCTTTAG
GCGCCGGCTTCCTTACCATAGGTGCTGCAAACCGGGGGTTTGAGGCAGCGAATGCTGCGAGAGCTGGCGG
ATCGTCACTTGCCGGCGCGGCGATGCGCGGCATGGAAGCCGCCGTTGGTGGGGCAGCCGGCGCCGTCGGC
TCCGCCGCAAAGGACAAGGCGATCGGCTCGCCCGGCGCCTATGCCGGATCGCTGCTCGGGCTTGCCAATG
CCAAGCTCGACCAGACGCAAAAGTCCGGAACGCCGTCCGCACCTCCGCCCATCAACGACAAAAAGTAA
 Primer design