SecReT4
Protein ID: 190014720
T4SS name [ID]Trb [251]
Gene symboltrbC
Locus tagpTiBo083
StrainAgrobacterium tumefaciens plasmid Ti plasmid pTiBo542 (NC_010929)
Repliconplasmid Ti plasmid pTiBo542 [GenBank: NC_010929] [Browse all T4SS(s) in this replicon]
Location [Strand]98298..98702 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA5WY03
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2e-20, Aligned region: 3..100
Protein Sequence: 134 a.a.     [Download]
>gi|190014720|ref|YP_001967484.1| TrbC [Agrobacterium tumefaciens]
MSRKISILFTAATLVAISIGFTDSALASSGGGGLPWESPLQQIQQSITGPVAGFIALAAVAIAGAMLIFG
GELNDFARRLCYVALVGGVLLGATQIVALFGATGASIGEAQAQAEQNTPEPTMTPATVVEGAHG
 
Nucleotide Sequence: 405 bp     [Download]
>gi|190014640|ref|NC_010929.1|:c98702-98298 Agrobacterium tumefaciens Ti plasmid pTiBo542, complete sequence
ATGTCGCGTAAAATCTCCATTCTTTTCACCGCCGCGACGCTTGTCGCCATTTCTATTGGCTTTACGGATT
CTGCACTCGCATCCTCGGGCGGCGGCGGTCTTCCTTGGGAGTCGCCACTGCAACAGATCCAGCAATCGAT
CACCGGACCTGTCGCAGGGTTTATCGCACTGGCTGCTGTCGCCATTGCCGGCGCCATGCTGATCTTCGGA
GGCGAGCTGAATGATTTCGCGAGACGGCTTTGCTATGTCGCGCTGGTGGGTGGCGTGCTTCTTGGGGCCA
CCCAAATCGTCGCTCTGTTCGGCGCGACCGGCGCCTCGATCGGCGAGGCTCAAGCACAGGCCGAGCAAAA
CACTCCCGAACCAACGATGACGCCGGCCACAGTGGTGGAGGGGGCTCATGGCTGA
 Primer design