SecReT4
Protein ID: 190014773
T4SS name [ID]VirB [15]
Gene symbolvirB7
Locus tagpTiBo139
StrainAgrobacterium tumefaciens plasmid Ti plasmid pTiBo542 (NC_010929)
Repliconplasmid Ti plasmid pTiBo542 [GenBank: NC_010929] [Browse all T4SS(s) in this replicon]
Location [Strand]158582..158749 [+]
Producttype IV secretion system lipoprotein VirB7
Component typeVirB7
UniProt IDA5WY56
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 55 a.a.     [Download]
>gi|190014773|ref|YP_001967537.1| VirB7 [Agrobacterium tumefaciens]
MKYCLLCLVVALSGCQTNDTLASCKGPIFPLNVGRWQPTPSDLQLGNSGGRYDGA
 
Nucleotide Sequence: 168 bp     [Download]
>gi|190014640|ref|NC_010929.1|:158582-158749 Agrobacterium tumefaciens Ti plasmid pTiBo542, complete sequence
ATGAAGTATTGCCTGCTGTGCCTAGTTGTCGCTTTGAGCGGCTGCCAGACAAACGACACATTAGCGAGCT
GCAAAGGCCCGATCTTCCCGCTGAATGTGGGGCGATGGCAGCCTACTCCGTCAGATCTTCAGCTCGGCAA
TTCGGGTGGACGCTATGACGGGGCCTGA
 Primer design