SecReT4
Protein ID: 190014774
T4SS name [ID]VirB [15]
Gene symbolvirB8
Locus tagpTiBo140
StrainAgrobacterium tumefaciens plasmid Ti plasmid pTiBo542 (NC_010929)
Repliconplasmid Ti plasmid pTiBo542 [GenBank: NC_010929] [Browse all T4SS(s) in this replicon]
Location [Strand]158736..159449 [+]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDA5WY57
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.2e-45, Aligned region: 23..227
Protein Sequence: 237 a.a.     [Download]
>gi|190014774|ref|YP_001967538.1| VirB8 [Agrobacterium tumefaciens]
MTGPEYAMLVARESLAEHYKEVEAFQTARAKSARRLSKLIAAVAAIAILGNVAQAFAIATMVPLSRLVPV
YLWIRPDGTVDSEVSVSRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPTVRQDYQQFF
NYPNPSSPQVILGKRGRVEVEHIASNDVTPSTQQIRYKRTLVVDGKMPVVSTWTATVRYEKVTSLPGRLR
LTNPAGLVVTSYQTSEDTVSNVGHSEP
 
Nucleotide Sequence: 714 bp     [Download]
>gi|190014640|ref|NC_010929.1|:158736-159449 Agrobacterium tumefaciens Ti plasmid pTiBo542, complete sequence
ATGACGGGGCCTGAATATGCCATGCTAGTGGCGCGCGAAAGCCTTGCCGAGCACTATAAGGAAGTAGAAG
CCTTTCAAACCGCGCGAGCGAAATCGGCGCGACGTCTCTCCAAACTCATTGCAGCTGTCGCAGCTATCGC
GATTTTGGGAAATGTTGCTCAAGCGTTCGCTATAGCCACAATGGTGCCGTTGAGCAGGCTTGTGCCCGTA
TATCTATGGATACGGCCGGACGGCACCGTTGACAGCGAGGTGTCTGTCTCGCGATTGCCTGCAACTCAAG
AGGAGGCCGTCGTTAACGCCTCATTGTGGGAGTACGTTCGCCTGCGCGAGAGTTATGATGCCGACACCGC
TCAGTACGCCTACGACCTGGTATCGAACTTCAGTGCCCCAACAGTGCGCCAGGATTACCAGCAATTCTTC
AACTATCCCAATCCCAGTTCGCCTCAAGTCATTCTTGGCAAACGCGGCAGGGTGGAGGTCGAGCACATCG
CTTCAAATGATGTAACTCCAAGCACGCAGCAAATTCGCTATAAAAGGACCCTCGTCGTTGACGGCAAAAT
GCCTGTGGTGAGTACGTGGACCGCGACAGTTCGCTACGAAAAGGTGACCAGCTTGCCCGGCAGATTGAGA
CTAACCAACCCGGCAGGTCTGGTTGTCACCTCCTATCAGACATCGGAAGATACCGTTTCAAACGTAGGCC
ACAGCGAACCATGA
 Primer design