SecReT4
Protein ID: 190014777
T4SS name [ID]VirB [15]
Gene symbolvirB11
Locus tagpTiBo143
StrainAgrobacterium tumefaciens plasmid Ti plasmid pTiBo542 (NC_010929)
Repliconplasmid Ti plasmid pTiBo542 [GenBank: NC_010929] [Browse all T4SS(s) in this replicon]
Location [Strand]161497..162528 [+]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDA5WY60
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.4e-58, Aligned region: 12..310
Protein Sequence: 343 a.a.     [Download]
>gi|190014777|ref|YP_001967541.1| VirB11 [Agrobacterium tumefaciens]
MEVDPQLRFLLKPILEWLDDPKTEEIAINRPGEAFVRQAGIFTKMPLPVSYDDLEDIAILAGALRKQDVG
PRNPLCATELPGGERLQICLPPTVPSGTVSLTIRRPSSRVSGLKEVSSRYDASRWNQWQTRRKRQNQDDE
AILQHFDNGDLEAFLHACVVSRLTMLLCGPTGSGKTTMSKTLISAIPPQERLITIEDTLELVIPHDNHVR
LLYSKNGAGLGAVSAEHLLQASLRMRPDRILLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPIQGFKKL
FSLVKSSAQGASLEDRTLIDMLSTAIDVIIPFRAYEDVYEVGEIWLAADARRRGETIGDLLNQ
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|190014640|ref|NC_010929.1|:161497-162528 Agrobacterium tumefaciens Ti plasmid pTiBo542, complete sequence
ATGGAAGTGGATCCGCAACTACGCTTTCTTCTGAAGCCGATTTTGGAATGGCTCGATGACCCGAAGACTG
AAGAAATTGCGATCAATCGACCTGGAGAGGCATTTGTGCGCCAAGCCGGCATTTTTACCAAGATGCCTTT
GCCCGTCTCTTATGATGATCTTGAAGATATCGCTATTTTAGCGGGCGCGCTGAGAAAGCAGGATGTCGGA
CCACGTAACCCCCTCTGCGCCACTGAACTTCCTGGTGGTGAACGACTACAAATCTGTCTGCCGCCGACCG
TTCCCTCGGGCACCGTCAGCTTGACCATTCGACGGCCAAGCTCGCGTGTTTCTGGTCTTAAAGAAGTCTC
CTCCCGTTATGATGCTTCGAGGTGGAACCAGTGGCAGACACGAAGGAAACGCCAAAATCAGGATGATGAA
GCTATCCTTCAGCATTTTGACAACGGGGATTTGGAAGCGTTTCTGCACGCATGCGTCGTCAGCCGACTGA
CGATGTTGCTATGTGGCCCTACCGGAAGCGGCAAGACAACAATGAGCAAGACCTTGATCAGCGCCATCCC
CCCCCAGGAAAGGCTAATCACCATAGAAGATACGCTCGAACTCGTCATTCCACACGATAATCATGTTAGA
CTACTCTACTCCAAGAACGGTGCTGGGCTGGGTGCTGTGAGCGCCGAGCACTTGCTCCAAGCAAGTCTGC
GTATGCGGCCGGACCGGATATTGCTTGGCGAGATGCGCGACGATGCAGCATGGGCTTATCTGAGTGAAGT
CGTCTCGGGACATCCGGGATCGATTTCAACAATACACGGCGCGAATCCAATCCAAGGATTCAAGAAACTG
TTTTCCCTTGTCAAAAGTAGCGCCCAAGGTGCTAGCTTGGAAGATCGCACACTGATTGACATGCTCTCTA
CGGCGATCGATGTCATCATTCCATTCCGTGCCTATGAGGACGTTTATGAAGTAGGCGAGATCTGGCTCGC
GGCGGACGCACGACGCCGGGGCGAGACCATAGGCGATCTCCTTAATCAATAG
 Primer design