SecReT4
Protein ID: 190014784
T4SS name [ID]VirB [15]
Gene symbolvirD4
Locus tagpTiBo150
StrainAgrobacterium tumefaciens plasmid Ti plasmid pTiBo542 (NC_010929)
Repliconplasmid Ti plasmid pTiBo542 [GenBank: NC_010929] [Browse all T4SS(s) in this replicon]
Location [Strand]167555..169513 [+]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDA5WY67
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.5e-159, Aligned region: 97..537
TraG-D_C [PF12696], Evalue: 1.7e-27, Aligned region: 391..509
TrwB_AAD_bind [PF10412], Evalue: 1.4e-22, Aligned region: 138..521
AAA_10 [PF12846], Evalue: 1.6e-06, Aligned region: 140..467
Protein Sequence: 652 a.a.     [Download]
>gi|190014784|ref|YP_001967548.1| VirD4 [Agrobacterium tumefaciens]
MNSSKTSPQRMTLSIVCSLAAGFCAASCYVTFRRGFNGEAMMTFDVFAFWYETPLYLGYASTVFWRGLSV
VIFTSLIVLSSQLIISLRNQKHHGTARWAEIGEMRHAGYLQRYSRIKGPIFGKTCGPLWFGSYLTNGEQP
HSLVVAPTRAGKGVGIVIPTLLTFKGSVIALDVKGELFELTSRARKASGDAVFKFSPLDPERKTHCYNPV
LDIAALPPERQFTETRRLAANLITAKGKGAEGFIDGARDLFVAGILTCIERGTPTIGAVYDLFAQPGEKY
KLFAQLAEESLNKEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWVDPLIKAATSRSDFSVYDLRRKKTC
IYLCVSPNDLEVLAPLMRLMFQQLVSILQRSLPGEDECHEVLFLLDEFKHLGKLEAIETAITTIAGYRGR
FMFIIQSLSALSGTYDDAGKQNFLSNTGVQVFMATADDETPTYISKAIGEYTFKARSTSYSQARMFDHNI
QISDQGAALLRPEQVRLLDDQSEIVLIKGRPPLKLRKVQYYSDRTLKGLFERQMGSLPEPAPLMLSDYSN
DQVQYHLAPIANFNEDAAPQNRTVAEDHGSVKVGADIPERVMGINGDEEQADAGEIPPESVVPPELTLAL
TAQQQLLDQIIALQQRSRSAPA
 
Nucleotide Sequence: 1959 bp     [Download]
>gi|190014640|ref|NC_010929.1|:167555-169513 Agrobacterium tumefaciens Ti plasmid pTiBo542, complete sequence
ATGAACTCCAGCAAGACTTCGCCCCAGCGTATGACCCTGAGCATCGTATGTTCGCTGGCAGCCGGTTTTT
GTGCGGCCAGCTGCTATGTAACGTTCCGCCGGGGCTTCAACGGCGAAGCGATGATGACGTTCGACGTTTT
CGCTTTTTGGTATGAGACCCCGCTTTACTTGGGTTATGCCAGCACCGTCTTCTGGCGTGGTTTATCTGTT
GTCATCTTTACCTCGCTGATCGTTCTTTCAAGTCAGCTCATCATATCGCTGCGCAATCAGAAGCATCATG
GGACAGCTCGTTGGGCAGAAATTGGCGAAATGCGGCATGCTGGTTATCTGCAGCGTTACAGTCGCATCAA
GGGGCCGATCTTTGGAAAGACATGTGGTCCCCTTTGGTTCGGCAGTTATTTGACCAATGGCGAACAGCCA
CACAGTCTTGTCGTCGCGCCAACGCGTGCTGGCAAAGGCGTCGGCATCGTCATTCCAACGCTGTTGACCT
TCAAGGGCTCGGTAATCGCCCTTGACGTCAAGGGAGAATTGTTTGAACTGACGTCCAGAGCACGCAAAGC
GAGCGGCGACGCAGTTTTCAAGTTCTCCCCCCTAGATCCTGAGCGGAAGACTCATTGTTACAATCCGGTC
CTGGATATTGCCGCACTTCCGCCCGAACGCCAGTTCACTGAAACACGCCGTCTAGCTGCGAACCTTATTA
CGGCTAAGGGAAAGGGAGCAGAAGGCTTTATTGACGGCGCACGTGACCTGTTCGTCGCGGGAATCCTTAC
CTGCATTGAGCGTGGCACACCAACGATTGGCGCGGTATATGACCTATTTGCGCAGCCTGGCGAAAAGTAT
AAGCTTTTTGCGCAACTCGCGGAGGAAAGCCTAAACAAAGAGGCTCAGCGTATCTTCGATAATATGGCGG
GCAACGACACGAAAATTCTGACATCGTACACCTCTGTGCTGGGCGACGGTGGACTGAACCTGTGGGTTGA
TCCGCTTATCAAAGCAGCGACAAGCCGGTCAGACTTTTCCGTTTACGATCTCCGGAGGAAGAAGACCTGC
ATTTATCTTTGTGTCAGTCCCAACGATCTGGAGGTCTTGGCACCACTTATGCGCCTGATGTTTCAGCAGC
TCGTGTCAATCTTGCAGAGATCGCTGCCAGGTGAAGACGAGTGCCATGAAGTTTTATTTCTCCTCGACGA
ATTCAAACACCTGGGCAAGCTTGAGGCCATAGAGACCGCGATCACAACCATCGCCGGTTACAGAGGCCGC
TTTATGTTTATTATTCAAAGTCTTTCGGCCTTGTCGGGCACATACGATGACGCAGGAAAACAAAACTTTC
TGAGCAATACTGGCGTACAAGTATTTATGGCCACGGCTGATGACGAAACTCCAACCTACATCTCAAAAGC
TATCGGCGAATATACGTTTAAAGCGCGTTCGACCTCTTACAGTCAAGCCAGAATGTTCGACCACAACATC
CAGATTTCTGATCAAGGTGCAGCCCTTTTGCGCCCCGAACAAGTGCGCCTGCTAGACGATCAGAGTGAAA
TCGTTCTCATCAAAGGGCGACCTCCACTCAAATTACGAAAGGTGCAGTATTATTCCGATCGTACGCTGAA
AGGCCTTTTCGAACGCCAGATGGGCTCTCTGCCTGAGCCCGCACCCTTGATGCTTTCCGACTATAGCAAC
GATCAAGTTCAATACCACTTGGCTCCGATAGCAAATTTTAATGAGGATGCTGCACCGCAAAACAGAACTG
TGGCCGAGGACCATGGAAGTGTTAAAGTCGGTGCTGATATCCCTGAACGCGTGATGGGAATAAATGGTGA
CGAGGAACAAGCCGATGCGGGCGAGATACCGCCGGAATCGGTTGTGCCTCCAGAATTGACGCTCGCTCTG
ACCGCTCAACAGCAATTGTTGGACCAGATTATTGCACTTCAGCAAAGATCGAGGTCCGCACCGGCATAG
 Primer design