SecReT4
Protein ID: 190014903
T4SS name [ID]Tra_F [92]
Gene symboltraX
Locus tagMAR045
StrainEscherichia coli plasmid pMAR7 (NC_010862)
Repliconplasmid pMAR7 [GenBank: NC_010862] [Browse all T4SS(s) in this replicon]
Location [Strand]41088..41834 [-]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDQ0H0A8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 4.1e-52, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|190014903|ref|YP_001965415.1| Acetylase [Escherichia coli]
MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLMVLDHANRILHLDQSWMFLVGRGAFPL
FALVWGLNLSRHTHIRQEAINRLWGWAVIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRTWWRSAE
TMLLLAMWLPFSGTSYGIAGLLMLAVSHRLYRAEDRMERLALVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVSCTGKSLPRFWYGDFFPTFYACHLTVLGVLAV
 
Nucleotide Sequence: 747 bp     [Download]
>gi|190014865|ref|NC_010862.1|:c41834-41088 Escherichia coli plasmid pMAR7, complete sequence
ATGACAACGGATAACACGAACACAACACGTAATGATTCACTGGCTGCCCGGACCGATACCTGGTTGCAGT
CGTTGCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTTCTGGA
CCATGCAAACCGCATTCTGCATCTGGACCAGTCGTGGATGTTTCTGGTCGGGCGTGGGGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATACGCATATCCGGCAGGAGGCCATTAACCGGCTGT
GGGGATGGGCGGTGATTGCCCAGTTCGCATATTATCTGGCCGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTTGCGGCACAGGTGCTGACATGGTGTGAAACGCGCACCTGGTGGCGTTCCGCAGAG
ACCATGTTGCTTCTGGCAATGTGGTTGCCTTTCTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCAGTCAGCCACAGGCTGTACCGGGCGGAAGACAGAATGGAACGTCTGGCGCTGGTCGCCTGCCTGCT
GGCTGTTATTCCGGCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCCGGCCTTGTGATGACGGTG
CTGACTGTTGGTCTGGTGTCCTGTACAGGGAAATCACTACCCCGTTTCTGGTACGGGGATTTTTTCCCGA
CGTTCTATGCCTGTCATCTTACTGTGCTGGGCGTTCTGGCTGTGTGA
 Primer design