SecReT4
Protein ID: 190014916
T4SS name [ID]Tra_F [92]
Gene symboltraQ
Locus tagMAR056
StrainEscherichia coli plasmid pMAR7 (NC_010862)
Repliconplasmid pMAR7 [GenBank: NC_010862] [Browse all T4SS(s) in this replicon]
Location [Strand]56862..57146 [-]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDQ0H095
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 2.4e-50, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|190014916|ref|YP_001965428.1| pilin chaperone [Escherichia coli]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMAEQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|190014865|ref|NC_010862.1|:c57146-56862 Escherichia coli plasmid pMAR7, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGCTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGCAGAGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design