SecReT4
Protein ID: 190014919
T4SS name [ID]Tra_F [92]
Gene symboltraF
Locus tagMAR059
StrainEscherichia coli plasmid pMAR7 (NC_010862)
Repliconplasmid pMAR7 [GenBank: NC_010862] [Browse all T4SS(s) in this replicon]
Location [Strand]57906..58667 [-]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDQ0H092
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.5e-78, Aligned region: 29..243
Protein Sequence: 253 a.a.     [Download]
>gi|190014919|ref|YP_001965431.1| putative disulfide-bond-forming protein [Escherichia coli]
MMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQTATKR
ALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSARKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQR
QAIAKLAEHYGIMFFYRGQDPIDGQLVQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVK
YFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 762 bp     [Download]
>gi|190014865|ref|NC_010862.1|:c58667-57906 Escherichia coli plasmid pMAR7, complete sequence
GTGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGT
CAGGAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCTGT
ACCTGCAGCCCCCCGTCAGGAACCGGATATTATGCAGAAACTGGCCGCACTGCAGACGGCAACAAAGCGG
GCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGCTGCAAAATTACT
GGACTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAGAAAGGCCATGCTGGCACATCCTGAACTGGACTA
TAACCTGCAGTACAGCCATTACAACGGCACGGTACGGAACCAGCTGGCAGCAGACCAGGCGCAGCAGCGA
CAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTTTTTTACCGGGGGCAGGACCCCATCGACG
GGCAACTGGTGCAGGTCATTAATGGCTTCCGGGATACGTATGGTCTGAGTGTTATTCCCGTTTCCGTGGA
TGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGCGTGAAA
TATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCATACGGCTTTATTT
CGCAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCCAATTTTTAA
 Primer design