SecReT4
Protein ID: 190015827
T4SS name [ID]VirB [450]
Gene symbolpilX7
Locus tagpSE34_20
StrainSalmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34 (NC_010860)
Repliconplasmid pSE34 [GenBank: NC_010860] [Browse all T4SS(s) in this replicon]
Location [Strand]12293..12421 [+]
ProductPilx7 protein
Component typeVirB7
UniProt IDA9LK60
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 42 a.a.     [Download]
>gi|190015827|ref|YP_001965342.1| Pilx7 protein [Salmonella enterica subsp. enterica serovar Enteritidis]
MKLLIVAFVTLCLAGCQASHKLPPVSGKSEPVNSAEVMQNGI
 
Nucleotide Sequence: 129 bp     [Download]
>gi|190015807|ref|NC_010860.1|:12293-12421 Salmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34, complete sequence
ATGAAACTACTTATTGTGGCTTTCGTGACGCTTTGTCTCGCTGGTTGTCAGGCGTCACATAAACTACCGC
CCGTTTCCGGGAAAAGCGAACCTGTTAATTCTGCTGAGGTAATGCAAAATGGAATTTAA
 Primer design