SecReT4
Protein ID: 190015828
T4SS name [ID]VirB [450]
Gene symbolpilX8
Locus tagpSE34_21
StrainSalmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34 (NC_010860)
Repliconplasmid pSE34 [GenBank: NC_010860] [Browse all T4SS(s) in this replicon]
Location [Strand]12411..13124 [+]
Producttype IV secretion system VirB8 component
Component typeVirB8
UniProt IDA9LK61
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.9e-47, Aligned region: 19..234
Protein Sequence: 237 a.a.     [Download]
>gi|190015828|ref|YP_001965343.1| type IV secretion system VirB8 component [Salmonella enterica subsp. enterica serovar Enteritidis]
MEFKLPGFKNKKDVTDSSVSFEEKNIALQERMNRIYKFGGIGGMLIGGLSLLALNAALPLKTTVVDAYLI
DKVTGVAERLTSVKKENLSENEAIARYFITQYIKHREGYNFFSLQHDYDYVMAYSAENVAADYNALFNSE
QAPKLVYNKAEKTAMVQDNPSVIISPSSRADDKDIGAYIRFRLTIRDVATGQTRQEFWNVRLTYRIEPQV
EMVSGERNNNPLKFVVTSYVRDKEARG
 
Nucleotide Sequence: 714 bp     [Download]
>gi|190015807|ref|NC_010860.1|:12411-13124 Salmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34, complete sequence
ATGGAATTTAAACTTCCCGGATTTAAAAATAAAAAAGACGTTACTGACTCATCAGTTTCATTTGAAGAAA
AAAACATTGCACTACAGGAGAGAATGAATCGTATTTATAAATTCGGTGGTATCGGAGGCATGTTAATTGG
TGGGCTGTCTTTACTTGCATTAAATGCAGCATTACCACTGAAAACAACAGTTGTTGATGCCTACCTTATC
GATAAGGTTACAGGTGTGGCTGAACGTCTGACTTCTGTTAAAAAAGAAAATCTTTCTGAAAACGAAGCCA
TTGCCCGATATTTTATCACCCAGTATATAAAACATCGTGAAGGTTATAATTTTTTCAGTCTCCAGCATGA
TTATGATTATGTAATGGCTTACAGCGCGGAGAATGTCGCGGCAGATTATAACGCATTATTTAACAGTGAA
CAGGCACCAAAACTTGTTTATAACAAAGCAGAAAAAACGGCAATGGTTCAGGATAATCCATCTGTCATAA
TTTCACCTTCGTCACGGGCAGATGATAAAGATATCGGTGCGTATATTCGTTTTCGTCTGACCATCAGGGA
TGTTGCTACCGGACAAACCCGCCAGGAGTTCTGGAATGTTCGCCTGACTTATCGTATCGAACCGCAGGTT
GAAATGGTGTCAGGGGAACGTAATAACAATCCTCTTAAATTCGTTGTAACAAGCTACGTTCGCGATAAAG
AAGCCAGAGGTTAA
 Primer design