SecReT4
Protein ID: 190015831
T4SS name [ID]VirB [450]
Gene symbolpilX11
Locus tagpSE34_24
StrainSalmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34 (NC_010860)
Repliconplasmid pSE34 [GenBank: NC_010860] [Browse all T4SS(s) in this replicon]
Location [Strand]15262..16293 [+]
ProductVirB11-like ATPase
Component typeVirB11
UniProt IDA9LK64
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.3e-50, Aligned region: 25..311
Protein Sequence: 343 a.a.     [Download]
>gi|190015831|ref|YP_001965346.1| VirB11-like ATPase [Salmonella enterica subsp. enterica serovar Enteritidis]
MNNENRHLIYDVVNDYFYHWLNEIEGVTEIAVNRPGEIFIKVRGKWQWYEQKMSYSDCLSFASTLADFHD
GGSVTPEYPLRSATLPGGERVQVVIPPATEKDTVSITIRKPSGIFISHDKFIKQGFYSRVSGLSGDSVME
DNISALITSGYFDRVIPESLRQGKTIVFCGGTGSGKTTFANACLEYIPHHLRCISIEDTDEAKFRFHKNH
VKLYYPAEGESKVITSASLLRSCFRMNPDRILMTEIRGAEAWDFLKASSSGHAGNITTVHESSPEYAVLG
IVQRCYMNPECQNLPFNVILRRVLSNIDIIMSIKYLDDEDFRFASGIYYKQLHFDDYFRKLKE
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|190015807|ref|NC_010860.1|:15262-16293 Salmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34, complete sequence
GTGAATAACGAAAACAGACATCTGATTTATGATGTGGTCAACGATTATTTTTATCACTGGCTGAATGAGA
TTGAGGGTGTCACGGAAATTGCTGTTAACCGACCAGGAGAAATATTTATAAAGGTCAGGGGAAAGTGGCA
ATGGTATGAACAAAAGATGAGTTACAGTGATTGTCTTTCTTTTGCATCCACACTGGCCGATTTTCATGAC
GGCGGTTCTGTGACTCCTGAATATCCCCTGCGCTCTGCCACGCTTCCGGGTGGAGAACGTGTTCAGGTTG
TGATCCCACCGGCAACTGAAAAAGACACTGTTTCTATAACAATCCGTAAGCCGTCAGGTATTTTTATCAG
TCATGACAAATTTATAAAACAGGGATTTTATTCACGCGTCAGTGGTTTAAGTGGTGACTCGGTTATGGAA
GATAATATTTCTGCTTTAATCACTTCCGGATATTTTGATCGGGTTATACCTGAATCACTGCGTCAGGGGA
AAACGATAGTTTTCTGTGGAGGGACGGGTTCAGGTAAAACTACCTTTGCAAATGCCTGTCTGGAATATAT
ACCGCATCATCTGCGGTGTATTTCTATTGAAGATACTGATGAGGCAAAATTCAGATTCCATAAAAACCAT
GTAAAACTTTACTATCCGGCAGAGGGTGAGAGTAAGGTTATTACCTCAGCGAGTCTTCTGCGTTCCTGTT
TTCGTATGAATCCGGACAGGATTCTGATGACAGAAATCAGGGGGGCTGAGGCATGGGATTTTCTGAAAGC
ATCGAGTTCAGGCCATGCAGGAAACATTACCACCGTTCACGAAAGTAGTCCTGAATATGCTGTGCTTGGG
ATTGTTCAGCGATGTTATATGAATCCTGAATGTCAGAATCTACCATTCAATGTCATTTTAAGACGTGTAC
TGAGTAATATTGATATTATCATGAGTATTAAATACCTTGATGATGAAGATTTTCGTTTCGCTTCCGGTAT
TTATTACAAACAACTTCATTTTGATGACTATTTCAGAAAACTGAAGGAGTGA
 Primer design