SecReT4
Protein ID: 190015832
T4SS name [ID]VirB [450]
Gene symboltaxB
Locus tagpSE34_25
StrainSalmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34 (NC_010860)
Repliconplasmid pSE34 [GenBank: NC_010860] [Browse all T4SS(s) in this replicon]
Location [Strand]16290..18131 [+]
ProductTaxB
Component typeVirD4
UniProt IDA9LK65
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.7e-143, Aligned region: 104..573
TraG-D_C [PF12696], Evalue: 4.6e-25, Aligned region: 418..536
TrwB_AAD_bind [PF10412], Evalue: 1.5e-18, Aligned region: 333..550
Protein Sequence: 613 a.a.     [Download]
>gi|190015832|ref|YP_001965347.1| TaxB [Salmonella enterica subsp. enterica serovar Enteritidis]
MIMSLKLPDKGQWVFIGLVMCLVTYYTGSVAVYFLNGKTPLYIWKNFDSMLLWRIITESNIRTDIRLTAI
PSLLSGMVSSLIVPVFIIWQLNKTAVALYGDAKFASDNDLRKSKLLKWEKENDTDILVGAYKGKYLWYTA
PDFVSLGAGTRAGKGAAIGIPNLLVRKHSLIALDPKQELWKITSKVREILLGNKVYLLDPFNSKTHQFNP
LFYIDLKAESGAKDLLKLIEILFPSYGMTGAEAHFNNLAGQYWTGLAKLLHFFINYEPSWLNEFGLKPVF
SIGSVVDLYSNIDRELILSKREELEGTNGLDENALYHLRDALTKIREYHETEDEQRSSIDGSFRKKMSLF
YLPTVRKCTDGNDFDLRQLRREDITVYVGVNAEDISLAYDFLNLFFNFVVEVTLRENPDFDPTLKHDCLM
FLDEFPSIGYMPIIKKGSGYIAGFKLKLLTIYQNISQLNEIYGIEGAKTLMSAHPCRIIYAVSEEDDAAK
ISEKLGYITTTSKSTSKNRGRSTSQGESESEARRALVLPQELGTLDFKEEFIILKGENPVKAEKALYYLD
PYFMDRLMKVSPKLASLTMKLNKTKKIFGVKGLKYPSKEKMLSVGELESEVLL
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|190015807|ref|NC_010860.1|:16290-18131 Salmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34, complete sequence
GTGATTATGTCTTTAAAACTCCCCGATAAAGGCCAGTGGGTTTTTATCGGTCTGGTTATGTGTCTCGTGA
CATATTATACTGGTTCTGTTGCTGTTTACTTCCTGAACGGAAAAACGCCGCTTTATATATGGAAAAATTT
TGATTCCATGCTCCTGTGGCGAATAATAACAGAGAGTAATATACGGACAGATATCAGGTTAACCGCTATC
CCCTCTCTTTTATCAGGTATGGTTTCGTCTCTCATCGTGCCTGTTTTTATTATCTGGCAACTGAATAAAA
CGGCTGTTGCTCTTTATGGTGACGCGAAGTTTGCCAGTGATAATGATTTAAGGAAATCGAAACTTCTGAA
ATGGGAGAAAGAAAACGATACTGATATTCTCGTCGGAGCATATAAAGGTAAATACCTGTGGTATACCGCA
CCAGATTTTGTATCACTTGGCGCAGGAACCCGCGCAGGTAAAGGTGCCGCCATTGGTATCCCTAATCTTC
TGGTCAGAAAACACTCTCTGATTGCGTTAGATCCAAAACAGGAATTGTGGAAAATCACCAGTAAGGTGCG
TGAAATACTGCTGGGTAATAAAGTTTATCTGCTCGACCCTTTCAACAGTAAAACACACCAGTTTAATCCC
CTTTTCTATATTGATTTAAAAGCGGAGAGTGGGGCTAAGGATCTGCTTAAACTGATTGAAATTCTGTTTC
CGTCTTATGGCATGACAGGGGCAGAAGCGCACTTTAATAATCTTGCGGGTCAATACTGGACAGGACTGGC
TAAGTTGCTTCATTTCTTTATTAACTATGAGCCGTCCTGGCTTAATGAGTTCGGGCTTAAACCCGTTTTC
TCAATCGGTTCTGTCGTCGACTTGTACAGCAATATTGACCGGGAACTGATACTCAGTAAGCGGGAAGAAC
TGGAGGGAACAAACGGGCTTGATGAAAACGCGTTGTATCATTTGCGCGATGCCCTGACCAAAATCAGGGA
ATATCACGAAACGGAAGATGAACAGCGTTCAAGCATTGATGGTTCTTTCCGTAAGAAAATGAGCCTGTTT
TATCTCCCAACCGTTCGTAAATGTACTGATGGTAATGATTTCGATCTCCGTCAGTTGCGACGGGAAGATA
TCACTGTTTATGTCGGTGTTAATGCGGAAGATATATCACTGGCTTACGATTTTCTGAACCTGTTTTTCAA
CTTCGTTGTTGAAGTGACATTGCGTGAAAATCCTGATTTTGATCCCACCCTGAAACATGACTGCCTGATG
TTTCTTGATGAGTTCCCTTCGATTGGTTATATGCCAATTATTAAAAAGGGATCAGGGTATATTGCAGGTT
TTAAACTTAAACTGCTGACAATTTATCAGAATATCAGTCAGCTAAATGAAATCTATGGTATTGAGGGAGC
CAAAACGCTGATGAGTGCTCATCCCTGCCGTATTATCTATGCTGTCAGCGAAGAGGATGATGCCGCGAAG
ATATCAGAAAAACTTGGGTATATTACCACTACATCAAAGAGCACAAGCAAGAACCGGGGACGATCAACTT
CACAGGGCGAATCAGAAAGTGAAGCCCGAAGAGCACTGGTGCTTCCACAGGAACTGGGAACGCTGGACTT
TAAAGAAGAGTTTATCATCCTGAAGGGGGAGAACCCTGTTAAAGCAGAAAAGGCACTTTATTACCTTGAT
CCGTATTTTATGGACAGGTTAATGAAGGTCAGTCCTAAACTGGCATCATTGACGATGAAACTAAATAAGA
CGAAAAAAATATTTGGTGTGAAAGGGCTTAAATATCCGTCAAAAGAAAAAATGCTCTCCGTAGGAGAGCT
GGAGTCTGAGGTTTTGCTATGA
 Primer design