SecReT4
Protein ID: 190404430
T4SS name [ID]Trb [325]
Gene symbol-
Locus tagpRi2659_p087
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]116222..117034 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA8W0B4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.2e-57, Aligned region: 57..268
Protein Sequence: 270 a.a.     [Download]
>gi|190404430|ref|YP_001961061.1| rcorf86 [Agrobacterium rhizogenes]
MQKTGLIAAAGCMAGLAFVVGAQAQSMTSNEVKGTNISRKWRGTPGLVTTGPDGKVIFLFGETQPSVVCS
PLQVCDIELQGGEIVRDVLVGDTVRWKVEPATSGATGGQAIHLIVKPSEPGLLTSMVVTTSRRTYHIQLK
SHPSQYMARVGFEYPEDTSTKLADINARLETGGIPGTAPDKLNFSYSISGGASWKPKRVYSDGVKTYIQF
PKSISGQDAPVLFVVSGGQNRIVNYRMKNNMMTVDYAIDKAILVSGVGWRQQKITIRRGG
 
Nucleotide Sequence: 813 bp     [Download]
>gi|190404344|ref|NC_010841.1|:c117034-116222 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGCAAAAGACAGGATTGATCGCAGCCGCCGGCTGCATGGCCGGACTCGCCTTTGTGGTGGGCGCGCAGG
CGCAAAGCATGACGAGCAACGAGGTCAAGGGTACGAATATCTCCCGCAAATGGCGCGGCACACCGGGCCT
GGTCACAACGGGACCGGACGGCAAAGTGATTTTTCTGTTCGGCGAGACCCAGCCGTCCGTCGTCTGCTCG
CCGCTGCAGGTCTGCGACATCGAGCTTCAGGGCGGTGAGATCGTTCGCGACGTGCTCGTCGGCGATACGG
TGCGGTGGAAAGTGGAGCCGGCCACCTCGGGGGCGACAGGCGGGCAGGCCATCCATCTGATTGTCAAACC
GTCGGAGCCAGGTCTTCTCACCTCGATGGTCGTCACCACCTCACGGCGAACCTATCATATCCAGCTCAAG
TCCCATCCCAGCCAGTACATGGCGCGCGTTGGTTTCGAGTACCCCGAGGACACCTCCACCAAGCTCGCCG
ACATCAATGCCCGTCTCGAAACCGGCGGCATTCCGGGCACGGCGCCGGATAAGCTGAACTTCTCCTATTC
GATCAGCGGCGGGGCTTCGTGGAAACCGAAGCGGGTCTATTCGGACGGGGTCAAGACCTACATCCAATTC
CCGAAGTCGATCTCAGGTCAGGATGCGCCGGTGCTCTTCGTCGTCTCCGGCGGTCAGAACCGCATCGTCA
ACTACCGGATGAAGAACAACATGATGACCGTCGACTATGCGATCGACAAGGCGATCCTCGTATCAGGGGT
CGGGTGGCGGCAGCAGAAGATCACCATCCGGCGGGGAGGCTGA
 Primer design