SecReT4
Protein ID: 190404432
T4SS name [ID]Trb [325]
Gene symbol-
Locus tagpRi2659_p089
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]117734..118915 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA8W0B8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.6e-32, Aligned region: 62..276
Protein Sequence: 393 a.a.     [Download]
>gi|190404432|ref|YP_001961063.1| rcorf88 [Agrobacterium rhizogenes]
MVKPAVTRSLLITGLFFLAYAAPAFAQEGQVLTELENQVSSAAKGWETTIMDAAKSLFWILATIEIGIAA
VWLAIQSASLDSWFAELVRRIMFVGFFAFVLTQGPTFARAVVDSLFQIGAGGGSASPAEVFDAGIRVASQ
MSQQAQFGVFEDNALAIAAVLAMGVVVICFSLVAAIFVSVMVEMYVGLLAGMIMLGLGGSSFTKDFAVRY
LVYAFGVGMKLMALVMIAKIGSQVLLGLANAPTASSDQFVTTLAIAGISVVVFIIAMYVPNIIQGVVQGA
SVTGGMETIRHGGQAASFAAGAGFLAAGAAGAGFAAAQAARAGGSSVAGAALRGIGASFSSGAQAAGSAA
KEKAIGSPGAYAGSILGLANAKLDEQRSGHSGPTPPPERNDKP
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|190404344|ref|NC_010841.1|:c118915-117734 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGGTGAAGCCCGCTGTCACACGTTCACTCCTGATAACTGGTCTGTTCTTCCTCGCCTATGCTGCTCCCG
CATTTGCGCAGGAGGGGCAGGTCCTCACGGAACTGGAAAACCAGGTCTCCTCTGCCGCGAAGGGCTGGGA
GACCACCATCATGGATGCGGCGAAATCGCTGTTCTGGATCCTCGCAACGATCGAGATCGGCATTGCCGCC
GTCTGGCTGGCGATCCAGTCAGCCTCGCTGGATAGCTGGTTTGCGGAGCTGGTGCGCCGGATCATGTTCG
TCGGGTTCTTCGCATTCGTTCTGACCCAAGGTCCGACCTTTGCCCGGGCGGTGGTTGACAGTCTTTTCCA
AATTGGTGCCGGCGGCGGTTCAGCCTCGCCCGCTGAAGTGTTCGATGCCGGCATTCGCGTCGCCTCGCAA
ATGTCGCAACAGGCGCAGTTCGGCGTATTCGAGGACAATGCGCTGGCGATTGCCGCGGTGCTGGCAATGG
GTGTCGTCGTCATCTGCTTTTCGCTGGTTGCCGCGATTTTTGTTTCGGTGATGGTTGAGATGTATGTCGG
CCTGCTCGCCGGCATGATCATGCTTGGCCTGGGCGGTTCCTCCTTCACCAAAGACTTTGCTGTTCGCTAT
CTTGTCTACGCCTTCGGCGTTGGCATGAAACTGATGGCGCTGGTGATGATCGCAAAGATTGGGTCACAGG
TCCTCTTGGGTCTGGCCAATGCCCCGACCGCATCCTCCGACCAGTTTGTCACCACCCTGGCGATCGCCGG
TATTTCCGTCGTGGTCTTCATCATCGCCATGTACGTGCCGAACATCATCCAGGGTGTCGTCCAGGGAGCC
TCCGTCACCGGCGGTATGGAGACAATCCGCCACGGCGGGCAAGCGGCGTCCTTCGCCGCGGGCGCTGGAT
TCTTGGCCGCCGGCGCTGCCGGCGCGGGTTTTGCGGCGGCCCAAGCCGCACGAGCTGGCGGTTCATCCGT
CGCTGGTGCTGCCCTGCGGGGGATAGGCGCAAGCTTCAGTTCCGGGGCACAAGCCGCAGGCTCGGCCGCG
AAGGAAAAGGCAATCGGATCTCCCGGTGCTTATGCGGGGTCCATCCTCGGACTAGCCAACGCCAAGCTCG
ATGAACAGCGCAGCGGTCACAGCGGCCCGACGCCTCCTCCCGAACGCAACGACAAACCATAA
 Primer design