SecReT4
Protein ID: 190404437
T4SS name [ID]Trb [325]
Gene symbol-
Locus tagpRi2659_p094
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]122640..123023 [-]
Productrcorf93
Component typeTrbC
UniProt IDA8W0D0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.6e-19, Aligned region: 5..99
Protein Sequence: 127 a.a.     [Download]
>gi|190404437|ref|YP_001961068.1| rcorf93 [Agrobacterium rhizogenes]
MSHRKSFIAVALLAAPIVLASVAPTLASSGGSLPWEGPLQQIQESITGPVAGAIALAAVAIAGGMLIFGG
ELNDFARRLVYVVLVAGILLGATNIVGLFGATGASIGLTSEQLTTIGSAGGGEGTHG
 
Nucleotide Sequence: 384 bp     [Download]
>gi|190404344|ref|NC_010841.1|:c123023-122640 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGTCGCATAGGAAATCATTCATCGCCGTCGCGCTCTTGGCGGCGCCCATCGTTCTCGCCTCGGTCGCGC
CGACCCTTGCCAGCTCCGGCGGCAGTCTCCCGTGGGAAGGGCCGCTGCAGCAGATCCAGGAGTCGATCAC
CGGCCCGGTCGCGGGTGCGATCGCGCTTGCAGCAGTCGCCATCGCCGGCGGCATGCTCATCTTCGGCGGC
GAACTGAATGATTTCGCGCGGCGACTTGTATACGTCGTTCTCGTCGCCGGCATCCTCCTCGGCGCCACCA
ACATCGTCGGCCTGTTTGGCGCAACCGGCGCCTCGATAGGACTGACGAGCGAACAGCTCACCACGATTGG
ATCGGCCGGAGGCGGGGAGGGAACTCATGGCTAA
 Primer design