SecReT4
Protein ID: 190404465
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p122
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]157955..158677 [+]
Producttype IV secretion system lytic transglycosylase VirB1
Component typeVirB1
UniProt IDQ9F5A2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 4.6e-26, Aligned region: 31..168
Protein Sequence: 240 a.a.     [Download]
>gi|190404465|ref|YP_001961096.1| rcorf121 [Agrobacterium rhizogenes]
MRKTAGSFGIIFLMVQPSKAAPLSFAEFNQLARECAPSVAPSTLGAIAKVESQFDPLVLHDNTTGETLHG
KNPADATQSVNNRVAAGHSVDVGLMQVNSKNFANLGLTAGNAINPCVSLSAAADLLVRHYSGGDTVESEQ
LAIRRAISAYNTGNPTRGFANGYVRRVEVAAQLLVPPLAQSGKKGDRDERSPEEPWNVWGSYDRSHSAVG
SSAPPEAQQPNERKSPEQDQVFEPNDGDAP
 
Nucleotide Sequence: 723 bp     [Download]
>gi|190404344|ref|NC_010841.1|:157955-158677 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGCGGAAGACGGCAGGATCTTTCGGGATCATTTTTCTGATGGTCCAGCCAAGCAAAGCTGCGCCGCTCT
CGTTCGCTGAATTTAACCAACTCGCTCGCGAATGCGCACCTTCAGTCGCTCCATCGACGCTTGGAGCGAT
TGCGAAGGTTGAAAGTCAGTTTGATCCGCTCGTGCTGCATGACAATACCACCGGCGAAACTTTACATGGC
AAGAATCCGGCGGATGCTACGCAAAGCGTAAACAATCGCGTCGCAGCAGGGCATTCAGTCGATGTAGGCC
TAATGCAAGTGAACTCGAAAAATTTCGCGAACTTGGGCTTGACTGCCGGCAATGCAATCAACCCTTGCGT
GTCCCTGTCGGCGGCGGCGGACCTGCTCGTACGGCATTATAGTGGCGGCGACACGGTAGAGTCAGAACAA
CTTGCCATCCGGCGAGCAATTTCGGCTTACAATACCGGCAACCCGACACGCGGCTTCGCGAACGGCTATG
TGCGGAGGGTCGAAGTGGCGGCTCAGCTACTCGTCCCCCCGCTGGCTCAGTCGGGGAAAAAAGGCGACCG
TGATGAGCGGAGTCCAGAAGAACCCTGGAACGTCTGGGGTTCATACGACCGCTCCCACTCAGCAGTCGGT
TCGTCCGCGCCGCCAGAGGCGCAGCAGCCGAATGAGCGCAAATCCCCCGAACAAGATCAAGTTTTCGAAC
CGAATGATGGAGATGCACCATAA
 Primer design