SecReT4
Protein ID: 190404466
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p123
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]158677..159042 [+]
Producttype IV secretion system pilin subunit VirB2
Component typeVirB2
UniProt IDQ9F5A1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-19, Aligned region: 27..115
Protein Sequence: 121 a.a.     [Download]
>gi|190404466|ref|YP_001961097.1| rcorf122 [Agrobacterium rhizogenes]
MAWLEGYRAPSKFRGLWHRAVRLLAPHVPSVTGAIGWSLFFCEPAAAQAAGGTDPATMVNNICTFILGPF
GQSLAVLGIVAIGVSWMFGRASLGLVAGVVGGIVIMFGASFLGQTLTGGGG
 
Nucleotide Sequence: 366 bp     [Download]
>gi|190404344|ref|NC_010841.1|:158677-159042 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGGCATGGCTTGAAGGATACCGCGCACCGTCGAAATTCCGTGGCCTCTGGCACAGAGCTGTGCGCCTGC
TGGCTCCGCACGTGCCGAGCGTCACCGGCGCGATCGGCTGGAGCTTGTTTTTCTGCGAGCCAGCTGCCGC
GCAGGCCGCTGGGGGCACTGACCCCGCCACCATGGTCAACAATATCTGCACGTTTATTCTCGGTCCGTTT
GGTCAATCGCTCGCCGTTCTTGGTATCGTAGCCATCGGGGTATCGTGGATGTTCGGCCGAGCTTCCCTTG
GTCTGGTAGCAGGTGTTGTTGGCGGGATCGTTATCATGTTTGGAGCCAGCTTTCTCGGCCAAACACTGAC
AGGGGGCGGGGGATGA
 Primer design