SecReT4
Protein ID: 190404467
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p124
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]159039..159365 [+]
Producttype IV secretion system protein VirB3
Component typeVirB3
UniProt IDQ9F5A0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 4.1e-19, Aligned region: 5..89
Protein Sequence: 108 a.a.     [Download]
>gi|190404467|ref|YP_001961098.1| rcorf123 [Agrobacterium rhizogenes]
MNADLEEATLYLAATRPALFFGVPLTLAGVFMMLAGFLIVVVQNPLYEIVLLPLWLGARLIVERDYNAAS
VVLLFLQTAGRSVDGHAWGGASVSPNPIRVASRGRGMT
 
Nucleotide Sequence: 327 bp     [Download]
>gi|190404344|ref|NC_010841.1|:159039-159365 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGAATGCCGATCTTGAAGAAGCCACACTCTACTTGGCGGCAACGAGACCTGCATTGTTCTTTGGGGTAC
CGCTGACGCTTGCTGGAGTTTTCATGATGTTGGCGGGGTTTCTCATCGTTGTTGTGCAGAACCCCCTCTA
TGAAATTGTTCTCTTGCCGCTGTGGCTTGGAGCGCGGCTCATCGTAGAGCGGGACTATAACGCGGCAAGC
GTGGTCTTGCTGTTTCTCCAGACGGCAGGGAGAAGCGTTGACGGCCATGCGTGGGGCGGCGCGAGCGTCA
GTCCCAACCCCATCAGAGTGGCGTCGCGAGGAAGAGGAATGACGTAA
 Primer design