SecReT4
Protein ID: 190404468
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p125
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]159365..161734 [+]
Producttype IV secretion system protein VirB4
Component typeVirB4
UniProt IDA8W0H5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.7e-60, Aligned region: 172..375
AAA_10 [PF12846], Evalue: 8.9e-25, Aligned region: 429..700
Protein Sequence: 789 a.a.     [Download]
>gi|190404468|ref|YP_001961099.1| rcorf124 [Agrobacterium rhizogenes]
MFGASGRTERSGEIYLPYVGHLSDHVVLLEDGSILTMAHISGLPFELEEVEVRNARCRAFNTLFRNIADD
NVSVYAHLVRHNDVPVPPVRHFRSTFASSLSETFERRVLSGKLFRNDHFLTLIVSPRTTLGKVGSRFTRR
YGKNPGDLAHQIRHLEDLWNVVAGALDGYGLRRLGIREKNQVLFTEIGEALRLIMTCRFLPVPVVSGSLG
ASVYTDRVICGKRALEIRAPKDRYVGSIFSFREYPAKTRPGMLNTLLSSSFPLVLSQSFSFLTRAQAHAK
LSLKSNQMTSSGDKAVTQIGELAQAEDSLASSEFVMGSHHLSLCVYGDDLDTLADYGARARTSLSDAGAV
IVQESIGMEAAYWSQLPGNHRWRTRPGAITSRNFAGLVSFENFPIGRKSGHWGGAVARFRTNGGTPFDYI
PHENDVGMTAIFGPIGRGKTTLMTFILAMLEQSVVDRSGTIVFFDKDRGGELLVRATGGTYLTLRRGVPS
GLAPLRGLEDTAAARDFLREWIVALIESDGRGGISPEENRRLERGIQRQLSFEPNMRSLAGLREFLLHGP
SEGAGARLQRWCRGNALGWAFDGESDEVKLDPSITGFDMTHLLEYEEVCAPAAAYLLHRIGAMVDGRRFV
MSCDEFRSYLLNQKFAAVVDKFLLTVRKNNGMLVLATQQPEHVLDSPLGASLVAQCMTKIFYPSPTADRS
AYIDGLKCTEREFQAIREEMAIGSRKFLLKRESGSVVCEFDLRDMPEYVAVLSGRANTVRFAQQLRETHG
EEPSAWLEKFMTRYHEAQD
 
Nucleotide Sequence: 2370 bp     [Download]
>gi|190404344|ref|NC_010841.1|:159365-161734 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGTTCGGAGCAAGCGGACGGACCGAGAGATCTGGGGAAATCTACCTGCCTTACGTAGGGCACCTCAGCG
ACCATGTCGTTCTTCTAGAGGACGGTTCCATCTTGACCATGGCGCATATCAGTGGCCTTCCCTTCGAACT
GGAGGAAGTAGAGGTCCGAAATGCGCGCTGCCGTGCCTTTAACACGCTCTTTCGCAATATTGCCGATGAT
AACGTCTCAGTATATGCCCATCTCGTCCGTCACAACGATGTGCCAGTACCGCCGGTACGCCATTTTCGCA
GCACCTTCGCGTCAAGCCTAAGCGAAACGTTCGAGCGGCGTGTTCTGTCTGGTAAACTGTTTCGAAACGA
CCACTTCCTCACGCTCATTGTCTCTCCTCGCACCACTCTCGGTAAAGTGGGAAGCAGATTCACCAGGCGC
TATGGGAAGAACCCAGGCGATCTTGCGCATCAGATCCGACATCTGGAGGATCTTTGGAACGTTGTCGCTG
GCGCGCTTGATGGGTATGGACTTCGTCGACTTGGCATCCGAGAAAAAAATCAGGTGCTTTTCACGGAAAT
TGGTGAAGCCCTTCGCCTGATAATGACTTGTCGTTTTTTACCGGTGCCGGTCGTTAGCGGATCCCTCGGC
GCCTCAGTTTATACCGACCGGGTCATCTGCGGCAAGCGTGCCCTCGAGATTAGAGCGCCGAAAGATCGTT
ACGTTGGATCTATCTTTTCATTCCGCGAGTACCCGGCAAAGACGCGGCCCGGAATGCTTAACACACTCCT
GTCATCAAGTTTTCCGCTCGTTTTGAGCCAGAGTTTCTCTTTCCTCACACGTGCACAGGCTCACGCCAAG
CTCAGCCTCAAATCGAACCAGATGACTAGCTCCGGTGACAAGGCGGTCACCCAGATCGGTGAACTCGCCC
AAGCAGAAGATTCATTGGCCAGTAGCGAATTCGTCATGGGTTCGCATCATCTCAGCCTTTGTGTCTATGG
CGATGATCTCGATACCCTTGCCGACTATGGTGCGCGAGCCCGCACGAGCTTGTCGGACGCGGGCGCGGTT
ATCGTGCAGGAAAGCATTGGAATGGAGGCTGCATACTGGTCTCAGCTTCCAGGAAACCACAGATGGCGTA
CCCGTCCCGGAGCGATCACTTCACGCAACTTTGCCGGCTTGGTTTCATTCGAGAACTTCCCTATCGGAAG
GAAGTCGGGCCATTGGGGAGGTGCGGTTGCTCGTTTCCGTACAAACGGCGGGACGCCCTTCGATTATATT
CCGCACGAAAACGACGTGGGCATGACCGCGATCTTCGGGCCGATTGGCAGGGGAAAAACGACACTTATGA
CCTTCATCCTGGCGATGCTTGAGCAGAGCGTGGTTGACCGCAGCGGGACGATCGTTTTTTTCGATAAGGA
TCGTGGCGGTGAACTGCTTGTGCGCGCCACCGGGGGCACGTACCTCACGTTACGACGAGGTGTCCCAAGC
GGCCTTGCACCTTTGCGCGGCCTAGAGGATACGGCAGCGGCGCGGGACTTTCTCCGCGAGTGGATCGTGG
CGCTGATTGAAAGCGACGGCAGGGGGGGAATTTCGCCGGAGGAAAATCGCCGCTTAGAGCGCGGTATCCA
ACGGCAACTTTCGTTTGAGCCTAACATGAGATCCCTTGCGGGCTTAAGGGAGTTCTTATTGCACGGGCCC
TCCGAAGGTGCGGGAGCTAGATTGCAGCGGTGGTGCCGAGGCAACGCTCTTGGCTGGGCGTTTGACGGCG
AATCGGACGAAGTGAAGTTAGATCCTTCGATTACGGGCTTCGATATGACCCATCTCCTCGAATATGAGGA
GGTATGCGCGCCGGCCGCAGCATACCTTTTGCATCGAATAGGAGCGATGGTAGATGGCCGACGCTTCGTC
ATGAGCTGCGATGAGTTTCGTTCCTACCTGCTTAATCAGAAATTCGCAGCAGTCGTCGACAAGTTCCTGC
TGACCGTCCGGAAGAACAACGGAATGTTAGTTCTTGCGACGCAGCAACCCGAGCACGTACTTGATTCACC
ATTGGGCGCAAGCCTCGTAGCACAATGTATGACCAAAATCTTCTACCCATCACCCACTGCAGACCGCTCT
GCTTACATAGACGGGTTGAAGTGCACCGAGCGAGAATTTCAGGCTATTCGCGAGGAGATGGCGATTGGCA
GCCGCAAATTTCTGCTGAAGCGCGAGAGCGGAAGTGTTGTGTGCGAATTCGATCTGCGCGACATGCCGGA
ATACGTCGCCGTACTATCCGGGCGTGCCAATACGGTGCGTTTTGCCCAGCAGTTGCGCGAGACGCATGGA
GAGGAACCCTCTGCCTGGCTGGAAAAATTCATGACGCGCTACCATGAGGCACAGGATTGA
 Primer design