SecReT4
Protein ID: 190404469
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p126
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]161751..162419 [+]
Producttype IV secretion system protein VirB5
Component typeVirB5
UniProt IDA8W0H6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 6.9e-06, Aligned region: 6..32
Protein Sequence: 222 a.a.     [Download]
>gi|190404469|ref|YP_001961100.1| rcorf125 [Agrobacterium rhizogenes]
MNITKLVINALFICLVLSGTAKAQFVVSDPATEAETLTTAINTAANLEQLITMVTMLTSPFGVTGMLSAI
DQKNQYPSAGQLDKEMFSPQMPASTTARAITLDADRAVVGDDAEGNLLRQQIAGAANAAGVAADNLDAMD
KRLAANSETSGQLSRSRNIMQATVTNGLLLKQIHDAIIQNIQATSLLTMTTAQAGLHEAEEAATQRKEHQ
ATALIFGAAQLH
 
Nucleotide Sequence: 669 bp     [Download]
>gi|190404344|ref|NC_010841.1|:161751-162419 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGAATATTACGAAGCTCGTAATAAACGCACTTTTCATATGCCTTGTTCTGTCGGGGACTGCCAAGGCGC
AGTTTGTTGTCAGCGACCCTGCAACGGAGGCCGAAACGCTGACGACAGCGATCAATACTGCGGCGAACCT
CGAGCAATTGATCACGATGGTGACAATGTTGACCTCGCCCTTTGGCGTCACCGGCATGTTATCAGCGATC
GACCAGAAAAACCAATATCCCTCTGCCGGCCAACTCGACAAGGAAATGTTTTCGCCGCAGATGCCTGCTT
CGACAACTGCGCGTGCAATTACCTTAGATGCCGATCGCGCAGTCGTGGGCGACGACGCTGAAGGAAATCT
TTTGCGACAGCAGATTGCAGGCGCCGCAAATGCTGCCGGTGTCGCGGCTGACAATCTGGATGCAATGGAC
AAGCGCCTTGCGGCAAATTCTGAGACATCGGGCCAGCTCTCCCGCTCACGCAATATCATGCAGGCCACCG
TCACCAACGGTTTGCTTCTCAAACAGATCCATGACGCAATTATTCAAAACATTCAGGCGACCAGCCTGTT
GACGATGACCACCGCACAGGCGGGGCTGCACGAGGCGGAGGAGGCGGCGACCCAACGAAAGGAACATCAG
GCAACTGCGCTTATATTTGGCGCCGCTCAACTGCACTGA
 Primer design