SecReT4
Protein ID: 190404470
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p127
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]162486..163373 [+]
Producttype IV secretion system protein VirB6
Component typeVirB6
UniProt IDQ9F597
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.9e-32, Aligned region: 43..270
Protein Sequence: 295 a.a.     [Download]
>gi|190404470|ref|YP_001961101.1| rcorf126 [Agrobacterium rhizogenes]
MNFSIPAPFTAIHTIFDLAFTVGLDTLLGDIQRAVSAPLVACVTLWIIVQGILVMRGEMDARGGITRVIM
VSVVVALIVEQAEYHDYVVSVFEDTIPNFIQQFGISGLPLQTIPAQLDTMFSLTQVAFQKIASEIGPMND
QDILAFQGAQWIFYGTLWTAFGIYDAVGILTKVLLAIGPLMLVGYLFDRTRDMAAKWIGQLVTYGILLLL
LNIVATIVVLTEATALVLMLGVITSAGTTAAKIIGLYELDMFFLTGDALIVALPAIAGNIGGSYWSGATQ
TAGSLNRHFARTIRR
 
Nucleotide Sequence: 888 bp     [Download]
>gi|190404344|ref|NC_010841.1|:162486-163373 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGAATTTTAGCATTCCTGCGCCTTTTACGGCGATACATACGATATTCGACCTCGCCTTCACCGTCGGGC
TGGACACGTTGCTTGGGGACATTCAACGGGCAGTCAGCGCTCCTCTCGTGGCCTGCGTGACGCTATGGAT
CATTGTCCAGGGCATCCTCGTAATGCGTGGGGAAATGGACGCACGGGGCGGAATCACCCGGGTAATCATG
GTATCGGTAGTTGTTGCTCTTATCGTTGAGCAGGCGGAATATCATGATTACGTTGTCTCGGTTTTCGAGG
ATACGATTCCGAATTTCATTCAACAGTTCGGTATCAGTGGGCTTCCTTTGCAGACGATTCCTGCTCAGCT
CGACACGATGTTTTCACTCACGCAAGTAGCCTTTCAGAAGATTGCTTCTGAAATTGGGCCGATGAACGAT
CAAGACATCCTCGCCTTTCAAGGCGCACAATGGATTTTCTATGGAACGCTTTGGACTGCGTTTGGAATCT
ACGATGCCGTCGGAATCCTCACCAAGGTGCTATTGGCGATCGGTCCATTGATGCTCGTTGGCTATCTCTT
CGATCGCACTAGAGACATGGCCGCGAAATGGATCGGCCAGCTCGTCACTTATGGCATACTTCTGCTTCTT
CTAAACATAGTGGCAACTATCGTGGTTCTGACGGAAGCGACGGCACTCGTGCTAATGCTCGGGGTTATCA
CTTCTGCTGGCACAACGGCGGCCAAGATAATAGGCCTCTATGAACTCGACATGTTCTTTCTGACCGGCGA
CGCCTTGATCGTCGCTCTTCCGGCAATCGCCGGGAATATTGGAGGGAGCTATTGGAGCGGTGCGACGCAA
ACGGCCGGTAGCTTAAATCGCCATTTCGCCCGGACAATCCGCCGTTAG
 Primer design