SecReT4
Protein ID: 190404471
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p128
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]163401..163568 [+]
Producttype IV secretion system lipoprotein VirB7
Component typeVirB7
UniProt IDQ9F596
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 55 a.a.     [Download]
>gi|190404471|ref|YP_001961102.1| rcorf127 [Agrobacterium rhizogenes]
MKYFLLFLIIGLASCQTSDQLATCKGPIFPLNVGRWQPAQSDLQPTNAGEANERL
 
Nucleotide Sequence: 168 bp     [Download]
>gi|190404344|ref|NC_010841.1|:163401-163568 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
TTGAAGTACTTTCTATTGTTTTTGATCATCGGCTTGGCGTCTTGTCAGACAAGCGATCAGTTGGCGACTT
GTAAGGGGCCTATTTTTCCGCTGAACGTCGGGCGATGGCAGCCTGCTCAGTCGGACCTTCAGCCTACCAA
CGCAGGAGAGGCTAATGAACGGCTCTGA
 Primer design