SecReT4
Protein ID: 190404472
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p129
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]163555..164268 [+]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDA8W0I0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-40, Aligned region: 23..227
Protein Sequence: 237 a.a.     [Download]
>gi|190404472|ref|YP_001961103.1| rcorf128 [Agrobacterium rhizogenes]
MNGSEYALLVEREALADHYKEVEAFQSARARSARRISRALAALAVIAVAGNVAQAFAIAVMLPLNKLVPV
YLWVRPDGTVDSEVSISRLPATQEQAVVNASLWEYVRLRESYSADTAQYAYDLVSSFSAPTVRQDYQQFF
NYPSPSSPQTIIGKRGKLEAEHIGSNELMTGVQQIRYKRTLIMEGQAPIVTTWTATVHYETVTNLPGRLR
LTNPGGLIVTSYQTSEDTVSNTTRSQQ
 
Nucleotide Sequence: 714 bp     [Download]
>gi|190404344|ref|NC_010841.1|:163555-164268 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGAACGGCTCTGAATACGCGCTGTTAGTAGAGCGGGAAGCATTGGCGGACCACTATAAGGAAGTAGAAG
CATTTCAGTCTGCACGTGCTAGATCAGCTCGGCGAATCTCTAGAGCCTTGGCTGCTTTGGCTGTCATTGC
AGTCGCAGGAAACGTGGCGCAGGCCTTCGCTATCGCCGTCATGCTTCCGCTGAACAAACTTGTTCCAGTA
TATCTGTGGGTGCGCCCAGACGGTACAGTTGACAGTGAGGTATCTATTTCGCGGTTGCCGGCGACGCAGG
AGCAAGCGGTCGTGAATGCGTCTCTATGGGAGTATGTTCGTCTGCGGGAGAGCTACTCGGCGGATACAGC
CCAATACGCCTATGATCTGGTCTCGAGCTTCAGTGCCCCAACGGTGCGTCAAGATTATCAGCAGTTCTTC
AATTACCCCAGTCCTAGCTCCCCCCAAACCATCATTGGTAAGCGCGGAAAGCTGGAAGCCGAGCACATCG
GCTCAAACGAACTTATGACTGGCGTCCAGCAGATCCGCTACAAACGCACTCTCATCATGGAAGGGCAAGC
TCCAATAGTAACCACCTGGACCGCAACGGTACATTATGAAACGGTAACTAACTTGCCCGGCCGATTGAGG
CTGACAAATCCAGGCGGCTTAATCGTTACCTCCTATCAAACTTCGGAAGATACCGTTTCGAACACGACGC
GGAGCCAGCAATGA
 Primer design