SecReT4
Protein ID: 190404473
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p130
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]164265..165143 [+]
Producttype IV secretion system protein VirB9
Component typeVirB9
UniProt IDA8W0I1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 8.4e-53, Aligned region: 31..266
Protein Sequence: 292 a.a.     [Download]
>gi|190404473|ref|YP_001961104.1| rcorf129 [Agrobacterium rhizogenes]
MIKNLFLGLVCILFVTSGANAEDTPAAGKLDPRMRYLAYNPDEVVHLSTAVGATLVVTFGSNEAVTAVAV
SNSKDLAALPRGNYLFFKASKVLQPQPVIVLTASDAGMRRYVFSLATRTMSRLDKEQPDLYYSVQFTYPA
DVAAARRKEAEQRDLADRMRAQAQYQRRAEDLLERPPAGGSTDAKNWSYVAQGDRSLLPLEVFDNGYSTT
FRFPGNVRVPSIYVINPDGKEATANYSVKGDYVEVASVSREWRLRDGHTVLCIWNKAYDAVGRKPGTGTV
RPDVVRVLKETR
 
Nucleotide Sequence: 879 bp     [Download]
>gi|190404344|ref|NC_010841.1|:164265-165143 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGATCAAGAATTTGTTTCTGGGCCTGGTTTGTATCCTCTTTGTAACCAGCGGCGCGAACGCGGAAGACA
CGCCAGCGGCAGGCAAACTGGATCCACGTATGCGCTATCTCGCCTACAATCCCGATGAGGTTGTGCACCT
TTCAACCGCTGTTGGAGCCACATTGGTCGTAACATTTGGGTCCAATGAAGCGGTGACAGCCGTCGCCGTT
TCCAACAGCAAAGATCTCGCTGCGCTCCCACGCGGCAATTATCTGTTTTTCAAGGCCAGCAAAGTGCTGC
AGCCGCAGCCTGTGATCGTCCTTACCGCAAGCGACGCAGGAATGCGGCGCTATGTTTTCAGCCTCGCGAC
CAGAACGATGTCTCGGCTCGATAAAGAGCAGCCTGACCTCTACTACAGCGTACAGTTCACTTATCCTGCC
GACGTTGCCGCTGCTCGCCGAAAAGAAGCGGAGCAGAGAGATCTTGCGGATCGGATGCGGGCGCAAGCAC
AATATCAGCGTCGAGCCGAGGACTTGCTCGAGCGTCCGCCAGCAGGTGGCAGCACAGATGCGAAAAATTG
GAGCTATGTCGCGCAAGGAGACCGCTCGCTATTACCGCTCGAGGTTTTCGACAACGGGTATTCCACGACA
TTTCGCTTTCCCGGAAACGTGCGTGTACCTTCAATCTACGTGATTAACCCAGATGGCAAGGAAGCCACGG
CCAACTATTCAGTTAAGGGAGATTACGTTGAAGTAGCATCAGTTTCCAGGGAATGGCGTCTGCGGGACGG
CCATACAGTACTTTGCATCTGGAATAAGGCATATGACGCCGTCGGACGGAAGCCGGGCACTGGCACAGTC
AGACCCGATGTAGTGCGCGTGCTGAAGGAGACGAGGTGA
 Primer design