SecReT4
Protein ID: 190404474
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p131
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]165143..166273 [+]
Producttype IV secretion system protein VirB10
Component typeVirB10
UniProt IDA8W0I2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.2e-60, Aligned region: 180..357
Protein Sequence: 376 a.a.     [Download]
>gi|190404474|ref|YP_001961105.1| rcorf130 [Agrobacterium rhizogenes]
MEDVNAQSREGIDAPGSLVTDPHGRRLSGSQKLLVAGLVLVLSLSLIWLGARSKKRTEPSPPNTMIDANT
KPFRPAPIDIPAKPAMTPPAAEATVLPSDQHQREHNELRPEETPIFAYSGGDQNGVKSAPHADIQNGGQD
NRNANSLAASEDSAENDLSVRLKPTVLQPSLAILLPHPDFTVTQGTIIPCILQTAIDTNLAGYVKCVLPQ
DIRGATGNVVLLDRGTTVVGEIQRGLQQGDARVFVLWNRAETPSHAVVSLSSPGADELGRSGLPGTVDNH
FWKRFSGAMLLSVVQGAVQAASSYAGNSTGGTSFNSFQNNGEQAADTALRAAINIPPTLKKNQGDTVSIF
VARDLDFSGIYQLHMTGGSVKRRHLR
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|190404344|ref|NC_010841.1|:165143-166273 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGGAGGACGTGAATGCCCAATCCAGAGAAGGTATCGACGCGCCCGGATCCCTCGTCACCGATCCTCATG
GCCGGCGCCTCTCGGGGTCGCAAAAGCTCCTTGTTGCGGGTTTAGTCCTGGTACTGTCGTTGAGCCTCAT
TTGGCTCGGGGCGCGTTCAAAGAAAAGGACCGAGCCGTCTCCACCAAACACAATGATCGATGCCAACACG
AAGCCCTTTCGGCCGGCCCCGATTGATATTCCCGCCAAACCGGCAATGACACCGCCAGCTGCGGAAGCAA
CGGTTTTGCCGTCGGATCAACATCAGCGAGAACACAACGAACTGAGGCCCGAAGAAACACCGATCTTTGC
CTACAGCGGAGGTGATCAGAATGGTGTCAAATCCGCCCCACACGCTGATATTCAGAACGGTGGCCAAGAC
AATAGAAACGCCAACTCCCTAGCCGCGTCGGAGGATTCTGCTGAGAACGATCTCTCTGTGCGCTTGAAAC
CGACAGTGTTGCAGCCTAGCCTCGCTATACTTTTGCCGCACCCAGATTTCACTGTTACGCAAGGAACGAT
CATTCCCTGCATACTGCAAACCGCCATTGATACAAATCTGGCAGGGTATGTGAAATGTGTACTTCCTCAA
GACATACGCGGAGCAACCGGAAATGTTGTGCTTCTGGATCGCGGAACGACAGTTGTCGGCGAAATCCAGC
GTGGACTGCAGCAGGGAGACGCCCGCGTTTTCGTTCTCTGGAATCGCGCGGAGACGCCCTCACACGCCGT
CGTCTCTCTTTCCTCCCCGGGGGCCGACGAACTCGGCCGTTCCGGACTGCCGGGTACGGTCGACAATCAT
TTCTGGAAACGCTTTAGCGGGGCCATGCTCCTGAGTGTCGTCCAGGGCGCAGTCCAGGCGGCAAGTAGCT
ACGCAGGGAATTCGACCGGCGGGACCAGCTTCAATAGTTTCCAAAACAATGGCGAACAAGCGGCCGATAC
GGCCCTAAGGGCGGCCATAAACATTCCCCCAACCTTGAAAAAAAATCAGGGTGACACGGTCTCGATCTTC
GTCGCGCGGGATTTGGATTTCTCAGGAATCTACCAGCTTCATATGACTGGTGGATCGGTGAAACGTCGGC
ATCTGCGCTAA
 Primer design