SecReT4
Protein ID: 190404475
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p132
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]166307..167341 [+]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDA8W0I3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.9e-59, Aligned region: 13..310
Protein Sequence: 344 a.a.     [Download]
>gi|190404475|ref|YP_001961106.1| rcorf131 [Agrobacterium rhizogenes]
MEVNPQLRALLNPVLQWLDDPRTEEVAINGPGEAFVRQSGVFTRFAAPFSYDDLEDIAILAGALRKQDVG
PRNPLCATELPGGERMQICLPPTVPSGTVSLTIRRPSNRVSELGEVSARYDVRRWNQWQIRTQRRDQLDE
AILRDYDNGDLESFLRACVIGKRTMLLCGPTGSGKTTMSKTLISAIPREERLITIEDTLELVIPHENHVR
LLYSKSGAGLGAVTAEQLLQASLRMRPDRILLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKL
FSLVKSSVQGACLEDRTLIDMLATAIDVIVPFRAYGDVYEVGEVWLAADARRRGETIGDLLNQQ
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|190404344|ref|NC_010841.1|:166307-167341 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGGAAGTAAATCCGCAATTGCGCGCCCTTCTTAACCCAGTCTTGCAATGGCTCGATGACCCGAGGACTG
AAGAAGTTGCCATAAACGGACCGGGAGAAGCCTTTGTACGCCAAAGTGGCGTCTTCACGAGGTTCGCCGC
ACCGTTCTCTTATGATGATCTCGAAGACATCGCCATTCTAGCAGGGGCATTGCGAAAACAAGATGTCGGC
CCCCGCAACCCTCTTTGCGCTACCGAGCTCCCAGGTGGCGAGCGGATGCAAATCTGCTTGCCGCCAACGG
TACCCTCTGGCACCGTGAGCTTGACAATTCGACGACCGAGCAATCGTGTCTCTGAATTGGGGGAAGTCTC
GGCTCGCTACGATGTTCGTCGATGGAATCAGTGGCAAATCCGGACGCAGCGACGAGATCAACTAGACGAA
GCGATTCTGCGCGACTACGACAATGGCGATCTGGAATCATTTTTACGTGCATGTGTTATCGGTAAGCGGA
CGATGTTGCTTTGTGGGCCGACCGGAAGCGGCAAGACCACGATGAGCAAGACCTTGATCAGTGCTATTCC
GCGGGAAGAAAGGCTGATAACCATTGAAGATACGCTCGAACTCGTCATTCCACATGAGAACCACGTCAGA
CTGCTCTACTCCAAGAGTGGGGCAGGGCTAGGTGCAGTGACTGCGGAACAGCTGCTCCAGGCAAGCCTTC
GGATGCGGCCTGACCGAATATTGCTCGGTGAGATGCGCGACGACGCGGCGTGGGCGTACCTGAGTGAGGT
GGTCTCAGGCCACCCCGGATCGATTTCAACCATACATGGGGCGAATCCCGTCCAAGGCTTCAAAAAGCTG
TTCTCACTTGTGAAGAGCAGTGTGCAGGGGGCATGCTTGGAAGATCGCACACTGATTGACATGTTGGCAA
CGGCAATCGATGTCATTGTTCCCTTCCGTGCTTACGGCGATGTTTACGAAGTGGGCGAAGTATGGCTCGC
CGCCGATGCCCGCCGACGCGGTGAGACGATAGGGGATCTTCTAAACCAGCAATAG
 Primer design