SecReT4
Protein ID: 190404484
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p141
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]175560..177542 [+]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDA8W0J5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 9.1e-155, Aligned region: 97..538
TraG-D_C [PF12696], Evalue: 1.4e-27, Aligned region: 391..509
TrwB_AAD_bind [PF10412], Evalue: 2.2e-23, Aligned region: 138..521
AAA_10 [PF12846], Evalue: 4.8e-07, Aligned region: 140..467
Protein Sequence: 660 a.a.     [Download]
>gi|190404484|ref|YP_001961115.1| rcorf140 [Agrobacterium rhizogenes]
MNSGKYTPIGLAASIACSLAVGFCAASLYVTFRHGFTGETMMTFNVFAFLYETPPYLGYASPTFYRGLAI
IVATSTLVLLCQLLLSMREREHHGTARWAGSGEMRHARYLRRYSHVTGPIFGKTCGPRWFGSYLSNGEQP
HSLVVAPTRAGKGVGVVIPTLLTFKGSVIALDVKGELFELTSRARKSSGDAVFKFSPLDPERRTHCYNPV
LDIAALPPERRFTETRRLAANLITAKGKGAEGFIDGARDLFVAGILSCIERGTPTIGAVYDLFAQPGEKY
KLFAQLAEETQNKEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWADPLVKAATSTSDFSVYDLRRKRTC
IYLCVSPNDLEVIAPLMRLLFQQVVSILQRSLPLGDERHEVLFLLDEFKHLGKLEAVETAITTIAGYKGR
FMFIIQSLSALTGTYDEAGKQNFLSNTGVQVFMATADDETPNYISKAIGDYTFQARSTSYSQARMFDHNI
QISDQGAPLLRAEQVRLLDDDYEIVLIKGQPPLKLRKVRYYSDFILKRIFESQHGSLPEPASLMLPGDTN
LVEGKLDQGTADTTSQKPVQIEENDHGEVVSPQNRTVADGVMPIEVRPRSNEVDDEREYQGADAATSEKL
PEIAPALLAQRELLDQIISLQLRGRTASGT
 
Nucleotide Sequence: 1983 bp     [Download]
>gi|190404344|ref|NC_010841.1|:175560-177542 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGAATTCAGGCAAGTACACGCCAATAGGCCTGGCTGCGAGCATAGCATGTTCATTGGCCGTGGGGTTTT
GTGCGGCCAGTCTCTATGTCACATTTCGCCATGGCTTTACGGGCGAAACGATGATGACTTTCAACGTTTT
TGCGTTCCTGTACGAGACACCGCCTTATTTGGGATACGCAAGTCCTACGTTCTATCGCGGACTAGCCATC
ATCGTTGCGACGTCAACGCTCGTGTTGCTATGCCAACTACTGTTATCGATGCGCGAGCGCGAACATCACG
GCACTGCTCGCTGGGCCGGCTCCGGCGAGATGCGGCACGCCAGGTACCTCCGGCGCTACAGTCACGTCAC
GGGTCCCATCTTCGGCAAGACATGTGGACCACGTTGGTTTGGCAGCTACCTAAGTAACGGAGAACAACCT
CACAGCCTTGTTGTCGCGCCAACTCGCGCTGGTAAGGGTGTCGGCGTCGTTATCCCGACGTTGCTAACCT
TCAAGGGCTCAGTAATTGCCTTGGATGTGAAAGGCGAGCTATTTGAACTCACATCGAGGGCGCGTAAATC
AAGTGGCGACGCGGTTTTCAAGTTCTCGCCCTTAGATCCAGAGCGGCGAACGCATTGTTACAATCCCGTG
CTGGATATTGCCGCGTTGCCGCCCGAACGGCGCTTTACAGAAACGCGCCGCCTCGCTGCGAATCTCATCA
CAGCCAAAGGCAAGGGAGCCGAAGGTTTCATCGACGGGGCACGGGATCTTTTCGTAGCAGGCATATTGAG
TTGCATTGAGCGCGGCACACCAACGATCGGTGCCGTTTACGATCTGTTTGCTCAGCCGGGTGAAAAGTAC
AAACTATTTGCGCAACTCGCGGAGGAAACACAAAACAAAGAGGCTCAGCGTATCTTCGACAATATGGCGG
GGAATGACACCAAAATCCTGACATCCTACACATCGGTGCTCGGCGACGGCGGACTCAATCTTTGGGCCGA
TCCACTCGTTAAAGCGGCTACAAGCACCTCGGATTTTTCCGTCTACGATCTGCGGCGGAAGAGGACTTGT
ATTTATCTTTGTGTCAGCCCGAACGATCTCGAAGTCATAGCGCCCTTGATGCGTCTTCTCTTCCAGCAGG
TTGTATCAATCCTGCAGCGATCGCTGCCACTTGGAGATGAACGGCACGAAGTTCTGTTTCTCCTCGATGA
GTTCAAGCACTTGGGCAAGCTGGAAGCTGTGGAGACGGCAATTACGACGATCGCCGGCTACAAGGGCCGC
TTCATGTTTATTATTCAGAGTCTTTCGGCTTTGACAGGAACTTATGATGAAGCTGGTAAGCAAAATTTTC
TCAGCAATACGGGTGTGCAGGTATTCATGGCGACTGCTGATGACGAGACGCCCAACTACATTTCCAAAGC
TATCGGCGACTACACATTCCAGGCTCGCTCAACGTCGTACAGCCAAGCGCGCATGTTTGATCATAACATC
CAAATCTCCGACCAAGGAGCACCGCTTTTGCGCGCCGAACAAGTCCGCCTACTCGACGACGATTATGAAA
TAGTCCTTATCAAAGGCCAACCTCCCCTCAAACTGAGAAAAGTGCGATATTATTCGGATTTCATATTGAA
GCGAATTTTCGAAAGCCAACACGGTTCCCTTCCCGAGCCCGCATCTTTGATGTTGCCGGGAGACACAAAC
CTCGTTGAAGGCAAGCTCGACCAGGGAACAGCCGATACAACTTCGCAAAAACCGGTGCAGATTGAAGAGA
ACGACCATGGGGAAGTCGTTTCCCCCCAAAACAGAACTGTGGCTGATGGAGTAATGCCAATAGAAGTTCG
CCCCCGTTCAAACGAAGTTGATGACGAGCGGGAATACCAAGGCGCGGACGCCGCAACCTCTGAGAAGCTT
CCGGAAATTGCTCCGGCTCTTTTGGCGCAGCGCGAACTCCTCGACCAGATCATTTCGCTCCAGCTACGAG
GTAGAACAGCCTCCGGCACTTGA
 Primer design