SecReT4
Protein ID: 190410132
T4SS name [ID]Trb [250]
Gene symbolorf157
Locus tagpSmeSM11b_p157
StrainSinorhizobium meliloti SM11 plasmid pSmeSM11b (NC_010865)
Repliconplasmid pSmeSM11b [GenBank: NC_010865] [Browse all T4SS(s) in this replicon]
Location [Strand]173083..173913 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA4KVR2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.3e-58, Aligned region: 61..274
Protein Sequence: 276 a.a.     [Download]
>gi|190410132|ref|YP_001965656.1| probable conjugal transfer protein TrbG [Sinorhizobium meliloti SM11]
MRTKQNHAALCCMLALAVSAGVASTSSAESLTSNEAKGTNLSTKWRGQAGLVTRGPDGKVIFLFGETQPS
VVCSPLQVCDIELQGGEIVRDVLVGDTVRWKVEPATSGAAGGQAIHLIVKPSEPGLVTSMVVTTSRRTYH
IQLKSHPTQYMARIGFEYPEDAATKLSDINARIQAMTGSDGGVAPEQLAFSYSVSGSAPWRPKRVYSDGQ
KTYIQFPRAISGQDAPVLFVVSGGQNRIVNYRMKNDMMIVDYNIDKAILISGVGWKQQKITIRRGG
 
Nucleotide Sequence: 831 bp     [Download]
>gi|190409975|ref|NC_010865.1|:c173913-173083 Sinorhizobium meliloti plasmid pSmeSM11b, complete sequence
ATGAGGACCAAACAAAACCACGCAGCCTTGTGCTGCATGCTGGCGCTTGCCGTATCGGCCGGTGTCGCTT
CGACCTCCAGTGCTGAAAGTCTGACGAGCAATGAGGCGAAAGGGACGAACCTCTCCACGAAATGGCGAGG
TCAGGCCGGCCTGGTGACACGTGGCCCGGACGGCAAGGTGATATTCCTCTTCGGAGAGACACAGCCGTCG
GTCGTCTGCTCTCCATTGCAGGTTTGCGATATCGAGCTGCAGGGCGGCGAAATCGTCCGCGACGTCCTTG
TCGGCGATACGGTGCGGTGGAAGGTCGAACCGGCCACGTCAGGCGCCGCCGGCGGCCAGGCCATTCACCT
CATCGTCAAACCTTCCGAGCCTGGGCTCGTAACCTCGATGGTGGTGACGACTTCGCGCAGAACCTATCAC
ATCCAGCTGAAGTCCCATCCGACCCAATACATGGCCCGTATTGGGTTCGAGTATCCCGAAGATGCCGCCA
CCAAGCTTTCCGATATCAACGCCCGCATCCAGGCGATGACCGGCTCGGATGGCGGGGTAGCCCCGGAACA
GCTTGCCTTTTCCTACTCGGTGAGCGGAAGCGCCCCGTGGCGACCGAAGCGAGTCTATTCCGATGGTCAG
AAGACCTACATCCAGTTCCCTCGCGCGATATCCGGCCAGGATGCGCCGGTTCTCTTCGTCGTATCGGGCG
GCCAGAACCGCATCGTCAATTACCGGATGAAGAACGACATGATGATCGTCGACTACAATATCGACAAGGC
GATCCTGATCTCCGGCGTGGGCTGGAAGCAGCAGAAAATCACAATCCGGCGGGGAGGGTGA
 Primer design