SecReT4
Protein ID: 190410134
T4SS name [ID]Trb [250]
Gene symbolorf159
Locus tagpSmeSM11b_p159
StrainSinorhizobium meliloti SM11 plasmid pSmeSM11b (NC_010865)
Repliconplasmid pSmeSM11b [GenBank: NC_010865] [Browse all T4SS(s) in this replicon]
Location [Strand]174613..175794 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA4KVR4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.9e-33, Aligned region: 63..276
Protein Sequence: 393 a.a.     [Download]
>gi|190410134|ref|YP_001965658.1| probable conjugal transfer protein TrbL [Sinorhizobium meliloti SM11]
MVRLVPKATFLIAGVVLLALAEPALAQQGQVLTELENQVSTSAKGWETTVMDAAKSLFWILAGIEVGIAG
VWLAIQAASLDSWFAELVRRIMFIGFFAFALTQGPTFAKAVVDSLFQIGAGGGSASPAEVFDAGIRVASQ
MSQQAKFGVFEDNALAIAAVLAMGVVVICFSLVAAIFVSVMVEMYVGLLAGMIMLGLGGSSFTKDFAIRY
LVYAFGVGMKLMALVMIAKIGSNVLLGLAQAPTAETDQFITTLAIAGISVVIFIIAMYVPNIIQGVVQGA
SVSGGMETIRHGGQAASFAAGGALLGAGAVGAGFAAAQAARASGSSTAGSVLRGMGASFSSGAMAAGSAA
KEKAIASPGAYAGSLLGLANAKLDQARGRSSPTATPPEKPEKP
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|190409975|ref|NC_010865.1|:c175794-174613 Sinorhizobium meliloti plasmid pSmeSM11b, complete sequence
ATGGTAAGGCTCGTTCCGAAAGCAACCTTTCTGATCGCGGGTGTGGTGCTTCTTGCTTTGGCGGAGCCAG
CCCTTGCTCAGCAGGGTCAGGTGCTGACCGAACTTGAAAACCAGGTCTCGACGTCTGCCAAGGGGTGGGA
AACCACCGTCATGGATGCGGCAAAGTCGCTATTCTGGATCCTCGCAGGTATCGAGGTCGGGATAGCCGGG
GTGTGGCTCGCGATCCAAGCCGCATCGCTAGACAGCTGGTTTGCCGAACTCGTCCGGCGCATCATGTTCA
TCGGCTTTTTCGCCTTCGCGCTGACACAAGGCCCGACTTTCGCTAAGGCCGTTGTCGACAGCCTGTTTCA
GATCGGGGCCGGCGGTGGCTCCGCCTCTCCGGCGGAGGTCTTTGACGCCGGTATTCGCGTTGCTTCCCAG
ATGTCGCAACAGGCCAAGTTCGGCGTCTTCGAGGATAACGCGCTCGCGATCGCCGCTGTGCTCGCGATGG
GTGTCGTTGTTATCTGCTTCTCGCTCGTCGCCGCCATTTTCGTCTCGGTCATGGTCGAGATGTATGTCGG
CCTACTGGCCGGCATGATCATGCTCGGGCTCGGTGGATCCTCCTTTACCAAGGACTTTGCGATCCGCTAT
CTCGTTTATGCCTTCGGCGTGGGGATGAAGCTGATGGCCCTGGTGATGATCGCCAAGATCGGCTCCAATG
TTCTGCTTGGCCTCGCGCAGGCGCCGACAGCCGAAACTGACCAGTTTATTACCACACTTGCCATCGCCGG
CATCTCCGTCGTCATCTTCATCATCGCAATGTACGTCCCGAACATCATCCAGGGCGTCGTTCAGGGCGCT
TCTGTCTCCGGCGGCATGGAGACGATCCGCCACGGCGGACAAGCTGCGTCATTTGCAGCGGGCGGCGCGC
TTCTGGGAGCTGGTGCCGTCGGGGCCGGCTTTGCCGCCGCGCAAGCAGCTAGGGCCAGTGGCTCGTCCAC
CGCAGGTTCAGTGCTGCGGGGCATGGGCGCGAGTTTCAGTTCCGGCGCTATGGCTGCCGGATCCGCTGCC
AAGGAAAAGGCAATCGCTTCACCCGGTGCTTATGCCGGCTCCTTACTTGGTCTTGCCAACGCGAAGCTCG
ATCAGGCGAGGGGCAGATCGTCGCCGACGGCGACACCGCCGGAAAAGCCCGAAAAACCCTAA
 Primer design