SecReT4
Protein ID: 190410140
T4SS name [ID]Trb [250]
Gene symbolorf165
Locus tagpSmeSM11b_p165
StrainSinorhizobium meliloti SM11 plasmid pSmeSM11b (NC_010865)
Repliconplasmid pSmeSM11b [GenBank: NC_010865] [Browse all T4SS(s) in this replicon]
Location [Strand]179524..179967 [-]
Productprobable conjugal transfer protein TrbC
Component typeTrbC
UniProt IDA4KVS0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.5e-20, Aligned region: 23..115
Protein Sequence: 147 a.a.     [Download]
>gi|190410140|ref|YP_001965664.1| probable conjugal transfer protein TrbC [Sinorhizobium meliloti SM11]
MARATRQNIIRRSMRTVMLHNRYLRLGTIGALICAALAGPALAGSGGSLPWEGPLEQIQQSITGPVAGYI
ALAAVAIAGGMLIFGGELNDFARRLMYVVLVAGILLGATTIVGLFGSTGASIGGSFVAEQPANPPSNPVG
GGEWRHG
 
Nucleotide Sequence: 444 bp     [Download]
>gi|190409975|ref|NC_010865.1|:c179967-179524 Sinorhizobium meliloti plasmid pSmeSM11b, complete sequence
ATGGCTCGCGCTACCAGACAGAACATTATCCGCAGATCGATGAGGACAGTCATGCTGCATAATCGCTATC
TCCGTTTGGGAACCATCGGCGCATTGATCTGCGCCGCGCTTGCCGGGCCTGCCTTAGCCGGCTCAGGCGG
GAGCCTGCCCTGGGAAGGCCCTCTCGAGCAGATCCAGCAGTCAATCACCGGACCTGTTGCCGGGTACATC
GCATTGGCGGCCGTCGCGATTGCCGGTGGCATGCTGATCTTCGGCGGAGAGCTCAACGACTTCGCGCGGC
GACTGATGTATGTCGTGCTCGTCGCAGGGATCCTGCTTGGCGCAACCACAATTGTTGGCCTCTTCGGATC
GACCGGCGCTTCGATCGGGGGCTCGTTTGTTGCTGAGCAACCTGCGAACCCTCCTTCAAATCCGGTCGGG
GGAGGGGAGTGGCGTCATGGCTGA
 Primer design