SecReT4
Protein ID: 190410172
T4SS name [ID]Tra_F [573]
Gene symbol-
Locus tagpK29_p003
StrainKlebsiella pneumoniae plasmid pK29 (NC_010870)
Repliconplasmid pK29 [GenBank: NC_010870] [Browse all T4SS(s) in this replicon]
Location [Strand]1316..1576 [+]
ProducttrhL
Component typeTraL_F
UniProt IDA7KFL3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 86 a.a.     [Download]
>gi|190410172|ref|YP_001965673.1| trhL [Klebsiella pneumoniae]
MPLLILFWDAKKLGLAFILVAFGNIFECFGFSVVAAVVYWIAYNKAAESGIRGLLKHKLWWLGFLPGKAV
FSSRYFNDPFIRDLYS
 
Nucleotide Sequence: 261 bp     [Download]
>gi|190410169|ref|NC_010870.1|:1316-1576 Klebsiella pneumoniae plasmid pK29, complete sequence
ATGCCTCTACTGATTTTGTTTTGGGATGCCAAAAAATTAGGGCTTGCATTCATTCTGGTTGCATTTGGGA
ATATCTTCGAATGCTTCGGGTTTTCTGTTGTAGCAGCGGTTGTGTATTGGATTGCGTATAACAAAGCAGC
TGAGTCAGGAATAAGAGGATTGCTAAAACACAAACTCTGGTGGCTCGGTTTTTTGCCAGGTAAAGCAGTT
TTTAGTAGCCGTTATTTCAACGATCCATTTATCAGAGATTTGTATTCTTGA
 Primer design