SecReT4
Protein ID: 190410352
T4SS name [ID]Tra_F [573]
Gene symbol-
Locus tagpK29_p185
StrainKlebsiella pneumoniae plasmid pK29 (NC_010870)
Repliconplasmid pK29 [GenBank: NC_010870] [Browse all T4SS(s) in this replicon]
Location [Strand]164580..165626 [-]
ProducttrhF
Component typeTraF_F
UniProt IDA7KG45
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.7e-50, Aligned region: 45..267
Thioredoxin_2 [PF13098], Evalue: 2.6e-07, Aligned region: 174..265
Protein Sequence: 348 a.a.     [Download]
>gi|190410352|ref|YP_001965855.1| trhF [Klebsiella pneumoniae]
MTRIALAPSKMVLLMSLVITGAHASPEQPLIKDTPFVSGQAYKKGFFWYDDPAKKSEAEEEEVLPPTGAA
SSPSKEEMVDLNSKWLKENMPRLLTQAMDNPTAENLSRYYTAQRLMLDISTRFSDKSKDYFLKNPMMSEK
RRQPVEKVALDAHRTVVEKNQQTVMKDIFTKSGLFFFFQSTCQFCHEESQILQFMQNYYSVDILPISMDG
RPLHNGLFQDFNIPNAQIIDQFKIREVPTIFLVSKDGTSAQRISEGMISADELKNTIILAAKGMNLIDDA
SFQSTLDIKRQYTIGDDGVITVNKSEMESDPFLLQKIMDQKLEGYDMPTADPVNYLNAGGSFGGTYAQ
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|190410169|ref|NC_010870.1|:c165626-164580 Klebsiella pneumoniae plasmid pK29, complete sequence
ATGACTCGTATTGCATTAGCGCCTTCAAAGATGGTTTTGCTTATGTCTTTGGTAATTACTGGTGCCCACG
CCAGCCCTGAGCAACCCCTAATAAAAGATACGCCCTTTGTATCTGGCCAGGCTTATAAGAAGGGTTTCTT
CTGGTATGACGATCCTGCTAAAAAAAGCGAAGCTGAAGAAGAAGAGGTTTTGCCACCAACCGGTGCTGCT
AGCTCGCCTTCAAAAGAGGAAATGGTAGATTTAAATTCAAAATGGCTAAAAGAGAATATGCCTCGACTGT
TAACGCAGGCAATGGATAACCCTACCGCAGAAAATCTATCACGTTATTACACGGCGCAAAGGTTAATGCT
GGATATCAGTACGCGTTTTTCTGACAAATCAAAAGATTATTTTCTTAAAAACCCGATGATGTCTGAAAAA
CGCAGGCAACCAGTGGAAAAGGTGGCACTGGATGCTCACCGCACTGTTGTTGAAAAAAATCAGCAAACGG
TAATGAAAGATATCTTTACTAAGTCAGGTTTATTTTTCTTTTTCCAGAGTACTTGCCAGTTTTGCCACGA
AGAAAGCCAAATACTTCAATTTATGCAGAACTATTATTCGGTAGATATTCTTCCAATCAGTATGGATGGA
AGGCCATTGCATAATGGCCTTTTTCAGGATTTTAACATCCCCAACGCACAAATTATTGATCAATTTAAAA
TTCGAGAGGTACCTACAATTTTCCTGGTTTCAAAGGATGGGACATCAGCTCAGCGCATTAGTGAAGGCAT
GATCTCCGCTGATGAATTAAAGAACACTATTATACTTGCCGCGAAGGGCATGAATCTGATCGATGACGCT
TCGTTCCAGTCAACTCTAGATATTAAAAGGCAATATACCATCGGCGATGATGGCGTTATTACCGTTAATA
AATCCGAAATGGAATCAGACCCATTCCTACTTCAAAAAATAATGGACCAAAAACTCGAAGGCTATGACAT
GCCTACGGCCGATCCGGTCAATTATCTCAATGCTGGCGGCAGTTTTGGAGGCACTTATGCGCAGTAA
 Primer design