SecReT4
Protein ID: 190570415
T4SS name [ID]VirB [222]
Gene symbolvirB11
Locus tagpRA3.19
StrainAeromonas hydrophila plasmid pRA3 (NC_010919)
Repliconplasmid pRA3 [GenBank: NC_010919] [Browse all T4SS(s) in this replicon]
Location [Strand]18196..19188 [-]
Productconjugal transfer protein VirB11
Component typeVirB11
UniProt IDQ209N1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.2e-67, Aligned region: 5..308
Protein Sequence: 330 a.a.     [Download]
>gi|190570415|ref|YP_001966836.1| conjugal transfer protein VirB11 [Aeromonas hydrophila]
MENLRILHPYLNRDGVTEIVINQPGEVITESRSGWERFDVPELNFNLCQDIAKLTATFSGQSLDERKPII
SATLPEGERVQIVVPPVTLSGRVSLTIRKPPTFNPTLDDYEKSGAFDQVIDYSSDLSEVERTLLELKQGR
KFKAFFELAIKSRLNIIVSGSTGSGKTTFMRSLLQLVPDDERLISIENVDELGLYKTHWNTVPLFYSAGG
QGVSEVSQQHLLESSLRMKPDRIFVAELIRGDEAFYYLRNVNSGHPGSITSMHANSARMAIEQLVLFLKE
SQSGSSMNREDIKQLLFMCVDIIVQIKNIRGKRVITEIYYDPEFKRTQMA
 
Nucleotide Sequence: 993 bp     [Download]
>gi|190570396|ref|NC_010919.1|:c19188-18196 Aeromonas hydrophila plasmid pRA3, complete sequence
ATGGAGAATCTTCGGATTCTCCATCCTTATTTGAACCGCGACGGCGTTACAGAAATCGTCATTAATCAAC
CAGGTGAGGTTATTACAGAAAGCCGCTCTGGCTGGGAACGCTTTGACGTACCCGAGTTGAATTTCAACCT
TTGCCAGGACATAGCCAAACTTACCGCCACGTTTTCCGGTCAGTCTCTCGATGAACGGAAGCCGATAATC
TCGGCCACCCTACCAGAGGGGGAACGTGTTCAAATTGTCGTGCCTCCGGTAACACTGTCTGGCCGTGTCA
GCCTGACAATCCGAAAGCCGCCTACATTTAACCCCACGCTGGATGATTACGAGAAAAGCGGGGCGTTTGA
CCAGGTAATTGATTATTCATCTGACCTTAGCGAAGTTGAACGAACTCTTTTAGAACTCAAGCAAGGCCGG
AAGTTTAAGGCGTTTTTTGAGCTGGCGATCAAGTCTCGCCTAAACATCATTGTGTCAGGCTCAACCGGTA
GCGGTAAGACTACGTTTATGCGCTCCCTGCTTCAGCTTGTGCCTGATGATGAACGCCTGATTAGCATCGA
GAACGTGGATGAATTGGGGCTCTATAAGACACACTGGAACACCGTTCCGCTGTTCTATTCAGCCGGTGGG
CAAGGGGTATCTGAAGTTAGTCAGCAACACCTGTTGGAAAGCTCATTGCGCATGAAGCCAGACCGGATTT
TTGTGGCTGAGTTGATCCGGGGGGATGAAGCCTTTTACTACCTGAGAAACGTCAACTCTGGCCACCCTGG
ATCGATTACCTCCATGCACGCCAACAGCGCCAGAATGGCTATAGAACAACTGGTTTTGTTCTTGAAGGAA
AGCCAAAGCGGCAGCTCGATGAATAGAGAGGATATTAAGCAACTTCTCTTTATGTGCGTCGATATTATCG
TGCAGATTAAAAACATTCGCGGGAAACGGGTAATAACGGAGATTTACTATGACCCAGAATTCAAACGGAC
ACAAATGGCGTAA
 Primer design