SecReT4
Protein ID: 190570418
T4SS name [ID]VirB [222]
Gene symbolvirB8
Locus tagpRA3.22
StrainAeromonas hydrophila plasmid pRA3 (NC_010919)
Repliconplasmid pRA3 [GenBank: NC_010919] [Browse all T4SS(s) in this replicon]
Location [Strand]21252..22001 [-]
ProductVirB8 protein
Component typeVirB8
UniProt IDQ209M8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.8e-58, Aligned region: 23..245
Protein Sequence: 249 a.a.     [Download]
>gi|190570418|ref|YP_001966839.1| VirB8 protein [Aeromonas hydrophila]
MTAKGDNKKPGKGKTIDQQYFEEARGWDSDAIAKTKQSERRAWRVAGVAVTVAILEAIGISSVLPLKTVE
PFVIRVDNNTGLTDVVSTLKEKDEGVKATAQEALNKYWLAQYIRHREGYLWDTRDYDREMVGLLSAPTIQ
QQYAEYTDPRKNPQAPIVVYGQNSEVETKVKAISMLNTGEELEGETRYTALVRYTKQVRRAGEFSPITHW
AATITFAYRNEPMRLDDRTKNPLGFQVISYRNDQEAGGL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|190570396|ref|NC_010919.1|:c22001-21252 Aeromonas hydrophila plasmid pRA3, complete sequence
ATGACGGCTAAAGGTGACAATAAAAAGCCTGGCAAGGGTAAAACCATCGACCAGCAATATTTTGAGGAAG
CGCGGGGCTGGGATAGCGATGCTATCGCCAAAACCAAGCAATCAGAGCGGCGGGCCTGGCGAGTTGCTGG
CGTGGCCGTGACAGTGGCCATCCTGGAAGCTATCGGGATCTCGTCTGTCCTCCCCCTCAAAACCGTTGAG
CCGTTTGTTATTCGGGTTGATAACAATACCGGCCTGACTGACGTTGTAAGCACCCTGAAGGAGAAGGACG
AAGGCGTAAAAGCCACAGCTCAAGAGGCGCTGAATAAATACTGGCTGGCGCAATATATCCGGCACCGTGA
GGGCTATTTGTGGGATACCCGTGACTATGATCGGGAAATGGTCGGCTTGCTCTCCGCACCGACGATACAA
CAGCAATATGCCGAATACACCGACCCCCGCAAAAACCCACAAGCGCCGATTGTGGTATATGGCCAAAACT
CCGAAGTAGAAACCAAGGTTAAAGCCATTTCCATGCTGAACACAGGGGAGGAGCTGGAAGGCGAAACCCG
TTATACCGCCCTGGTTCGCTATACCAAGCAGGTGCGCCGTGCCGGTGAGTTCTCACCGATCACCCACTGG
GCCGCGACGATCACGTTTGCTTATCGCAATGAGCCTATGAGGCTCGACGACCGCACCAAAAACCCGCTTG
GCTTCCAAGTGATTTCCTATCGCAATGACCAAGAAGCCGGGGGACTCTAA
 Primer design