SecReT4
Protein ID: 190570419
T4SS name [ID]VirB [222]
Gene symbol-
Locus tagpRA3.23
StrainAeromonas hydrophila plasmid pRA3 (NC_010919)
Repliconplasmid pRA3 [GenBank: NC_010919] [Browse all T4SS(s) in this replicon]
Location [Strand]22001..22207 [-]
Productputative lipoprotein
Component typeVirB7
UniProt IDQ209M7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 68 a.a.     [Download]
>gi|190570419|ref|YP_001966840.1| putative lipoprotein [Aeromonas hydrophila]
MKKTLLMIALALSATGCTLSPPPPPQCVDDGRGMVPLNPEMLTQEQIKAVKAKYQETTWKDERTKGAR
 
Nucleotide Sequence: 207 bp     [Download]
>gi|190570396|ref|NC_010919.1|:c22207-22001 Aeromonas hydrophila plasmid pRA3, complete sequence
ATGAAGAAAACCCTTTTGATGATTGCTTTGGCTCTGTCTGCCACTGGCTGCACCCTTTCCCCGCCTCCAC
CTCCGCAATGTGTGGATGATGGGCGCGGGATGGTTCCGCTTAACCCGGAAATGCTGACCCAGGAGCAGAT
CAAGGCCGTGAAGGCCAAATACCAGGAAACAACCTGGAAGGACGAACGTACTAAGGGAGCACGGTAA
 Primer design