SecReT4
Protein ID: 190570592
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_0130
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]137172..137822 [-]
ProductPutative type IV secretion system protein VirB8
Component typeVirB8
UniProt IDB3CNA5
KEGG IDwpi:WPa_0130
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.5e-09, Aligned region: 28..213
Protein Sequence: 216 a.a.     [Download]
>gi|190570592|ref|YP_001974950.1| Putative type IV secretion system protein VirB8 [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MEVESVKNKSYFRKAVEWYCHRYLFCVVERSWMALITLLLLVCLFLSLLNIYLLLPVKKDLNFVKYTNHT
EDEFSTIHKLSFSKKEDEYTSIARYLVSQYVEAYESSQIVESKYQENFIKNNSIYKIYQDFQEKVNNEAV
SSTKKITNINVTTLSIDRSIKDLVKFAGNATVLFAAEQNKKMKDYAVEVSFTLSNMKATLTGIIPFKFIV
NGYKYS
 
Nucleotide Sequence: 651 bp     [Download]
>gi|190570478|ref|NC_010981.1|:c137822-137172 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGGAAGTTGAATCAGTAAAAAACAAAAGTTATTTCAGGAAAGCAGTAGAATGGTATTGCCACAGATACC
TGTTCTGCGTTGTAGAAAGATCTTGGATGGCGTTAATAACGTTACTTCTCTTAGTATGTTTATTTTTATC
ATTACTAAACATATACCTATTACTTCCTGTTAAAAAAGATTTAAATTTTGTGAAGTACACGAACCACACA
GAAGATGAGTTTTCTACAATACATAAACTTAGTTTTAGTAAAAAAGAAGATGAATACACTTCCATAGCAA
GGTACTTGGTAAGTCAATACGTCGAAGCATACGAGTCCTCTCAGATCGTTGAATCAAAGTATCAAGAAAA
TTTTATAAAAAACAATTCTATATATAAAATCTATCAAGACTTTCAGGAAAAAGTAAACAATGAAGCTGTT
TCATCCACAAAAAAAATTACCAACATAAACGTAACAACACTATCTATTGACCGATCGATCAAGGACTTAG
TTAAATTTGCTGGAAATGCCACTGTACTTTTTGCAGCTGAGCAAAATAAGAAAATGAAAGACTATGCTGT
GGAGGTTAGCTTTACTTTATCAAACATGAAAGCAACTCTAACTGGTATAATACCATTTAAATTTATTGTT
AACGGCTATAAATACAGCTGA
 Primer design